Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c4hg6A_

Fold library idPDB HeaderMoleculeTitle
c4hg6A_PDB header: transferaseChain: A: PDB Molecule: cellulose synthase subunit a;PDBTitle: structure of a cellulose synthase - cellulose translocation2 intermediate


Added to library: Thu Jan 10 07:45:14 2013
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence VVPVLLFLLWVALLVPFGLLAAAPVAPSAQGLIALSAVVLVALLKPFADKMVPRFLLLSAASMLVMRYWF
Predicted secondary structure











SS confidence





































































Known secondary structure (DSSP)
TS


GGGTTS
 .........80.........90.........100.........110.........120.........130.........140
Sequence WRLFETLPPPALDASFLFALLLFAVETFSISIFFLNGFLSADPTDRPFPRPLQPEELPTVDILVPSYNEP
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP) TS


SS
TTS










TTT



TT

 .........150.........160.........170.........180.........190.........200.........210
Sequence ADMLSVTLAAAKNMIYPARLRTVVLCDDGGTDQRCMSPDPELAQKAQERRRELQQLCRELGVVYSTRERN
Predicted secondary structure














SS confidence





































































Known secondary structure (DSSP) TSS

TT

STT
T
SST

SS
 .........220.........230.........240.........250.........260.........270.........280
Sequence EHAKAGNMSAALERLKGELVVVFDADHVPSRDFLARTVGYFVEDPDLFLVQTPHFFINPDPIQRNLALGD
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP)
S


S

TT
TTSSS





BSS

T

T
 .........290.........300.........310.........320.........330.........340.........350
Sequence RCPPENEMFYGKIHRGLDRWGGAFFCGSAAVLRRRALDEAGGFAGETITEDAETALEIHSRGWKSLYIDR
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP) TS

TTTTT




SSSTT


SSSSTTT




 .........360.........370.........380.........390.........400.........410.........420
Sequence AMIAGLQPETFASFIQQRGRWATGMMQMLLLKNPLFRRGLGIAQRLCYLNSMSFWFFPLVRMMFLVAPLI
Predicted secondary structure

















SS confidence





































































Known secondary structure (DSSP)





SS
TTS
SS

TT
 .........430.........440.........450.........460.........470.........480.........490
Sequence YLFFGIEIFVATFEEVLAYMPGYLAVSFLVQNALFARQRWPLVSEVYEVAQAPYLARAIVTTLLRPRSAR
Predicted secondary structure















SS confidence





































































Known secondary structure (DSSP)



S


TTTS
TTSTT


 .........500.........510.........520.........530.........540.........550.........560
Sequence FAVTAKDETLSENYISPIYRPLLFTFLLCLSGVLATLVRWVAFPGDRSVLLVVGGWAVLNVLLVGFALRA
Predicted secondary structure

















SS confidence





































































Known secondary structure (DSSP)









SS

B
TT

GGGTT
 .........570.........580.........590.........600.........610.........620.........630
Sequence VAEKQQRRAAPRVQMEVPAEAQIPAFGNRSLTATVLDASTSGVRLLVRLPGVGDPHPALEAGGLIQFQPK
Predicted secondary structure








































SS confidence





































































Known secondary structure (DSSP) TB



S





STTTTS

SS


SSSSGGG

TT


 .........640.........650.........660.........670.........680.........690.........700
Sequence FPDAPQLERMVRGRIRSARREGGTVMVGVIFEAGQPIAVRETVAYLIFGESAHWRTMREATMRPIGLLHG
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP)
SSS
S




SS




S
S




 .........710.........720.........730.........740.......
Sequence MARILWMAAASLPKTARDFMDEPARRRRRHEEPKEKQAHLLAFGTDF
Predicted secondary structure













SS confidence














































Known secondary structure (DSSP) TS






SSS
S



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D