Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c4hg3C_

Fold library idPDB HeaderMoleculeTitle
c4hg3C_PDB header: hydrolaseChain: C: PDB Molecule: probable hydrolase nit2;PDBTitle: structural insights into yeast nit2 ligand recognition and exploration


Added to library: Sat Aug 3 08:33:52 2013
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence LKRVAVAQLCSSADLTKNLKVVKELISEAIQKKADVVFLPEASDYLSQNPLHSRYLAQKSPKFIRQLQSS
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP)
B


S
TT
S

TTSS


SSTT
 .........80.........90.........100.........110.........120.........130.........140
Sequence ITDLVRDNSRNIDVSIGVHLPPSEQDLLEGNDRVRNVLLYIDHEGKILQEYQKLHLFDVDVPNGPILKES
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP) T





TT



TTS

SS


TTS
GG
 .........150.........160.........170.........180.........190.........200.........210
Sequence KSVQPGKAIPDIIESPLGKLGSAICYDIRFPEFSLKLRSMGAEILCFPSAFTIKTGEAHWELLGRARAVD
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP) GT


S



TT

GGGGG
TT
S

B


 .........220.........230.........240.........250.........260.........270.........280
Sequence TQCYVLMPGQVGMHDLSDPEWEKQSHMSALEKSSRRESWGHSMVIDPWGKIIAHADPSTVGPQLILADLD
Predicted secondary structure











































SS confidence





































































Known secondary structure (DSSP) T

BB


TT

GGG






TTS


TTS
S

 .........290.........300...
Sequence RELLQEIRNKMPLWNQRRDDLFH
Predicted secondary structure












SS confidence






















Known secondary structure (DSSP) S
GGGS



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D