Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c4hbdA_

Fold library idPDB HeaderMoleculeTitle
c4hbdA_PDB header: protein bindingChain: A: PDB Molecule: kn motif and ankyrin repeat domain-containing protein 2;PDBTitle: crystal structure of kank2 ankyrin repeats


Added to library: Wed Jan 9 22:07:01 2013
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MELSPDLISACLALEKYLDNPNALTERELKVAYTTVLQEWLRLACRSDAHPELVRRHLVTFRAMSARLLD
Predicted secondary structure

















SS confidence





































































Known secondary structure (DSSP)




TTSS
STT


 .........80.........90.........100.........110.........120.........130.........140
Sequence YVVNIADSNGNTALHYSVSHANFPVVQQLLDSGVCKVDKQNRAGYSPIMLTALATLKTQDDIETVLQLFR
Predicted secondary structure














































SS confidence





































































Known secondary structure (DSSP) T


TTS

TT
TS


TT


TTS

GGG



S
 .........150.........160.........170.........180.........190.........200.........210
Sequence LGNINAKASQAGQTALMLAVSHGRVDVVKALLACEADVNVQDDDGSTALMCACEHGHKEIAGLLLAVPSC
Predicted secondary structure









































SS confidence





































































Known secondary structure (DSSP) S
TT


TTT


TT
TT

TT


TTS

T
TSTT
 .........220.........230.........240.....
Sequence DISLTDRDGSTALMVALDAGQSEIASMLYSRMNIK
Predicted secondary structure
















SS confidence


































Known secondary structure (DSSP)
TT


TTS

T





Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D