Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c4h18D_

Fold library idPDB HeaderMoleculeTitle
c4h18D_PDB header: transferaseChain: D: PDB Molecule: cmt1;PDBTitle: three dimensional structure of corynomycoloyl tranferase c


Added to library: Sat Sep 28 08:28:50 2013
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence AEVTPADVAGDTALSTISDSAPADEASAPRWRAHVNAADERVKEMWAYSPSMDRNVPLVVITADESAGPR
Predicted secondary structure




















































SS confidence





































































Known secondary structure (DSSP)

S
TT



SS

TT

S

TTS
TTTTTT


GGG
S
 .........80.........90.........100.........110.........120.........130.........140
Sequence PVIYLLNGGDGGEGAANWVMQTDVLDFYLEKNVNVVIPMEGKFSYYTDWVEENASLGGKQMWETFLVKEL
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP)


TTTTSSSSSS
TSS



TTSTTSB
SS
BGGGTB

BTTS
 .........150.........160.........170.........180.........190.........200.........210
Sequence PGPLEEKLNTDGQRAIAGMSMSATTSLLFPQHFPGFYDAAASFSGCAATSSLLPWEYLKLTLDRGNATPE
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP) T

S
TSTTT
SS

S

SSGGGT

 .........220.........230.........240.........250.........260.........270.........280
Sequence QMWGPRGGEYNIYNDALINSDKLRGTELYVSNASGETVVTGGIIEAATNKCTHDLKAKLDSAGIPADWNL
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP) SSTTST
TTTTGGGGTTS




T



 .........290.........300......
Sequence RPTHSWGWWQDDLRGSWTTFARAFEL
Predicted secondary structure







SS confidence

























Known secondary structure (DSSP)



TT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D