Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c4h18D_

Fold library idPDB HeaderMoleculeTitle
c4h18D_PDB header: transferaseChain: D: PDB Molecule: cmt1;PDBTitle: three dimensional structure of corynomycoloyl tranferase c


Added to library: Sat Sep 28 08:28:50 2013
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence AEVTPADVAGDTALSTISDSAPADEASAPRWRAHVNAADERVKEMWAYSPSMDRNVPLVVITADESAGPR
Predicted secondary structure




















































SS confidence





































































Known secondary structure (DSSP)

S
TT



SS

TT

S

TTS
TTTTTT


GGG
S
 .........80.........90.........100.........110.........120.........130.........140
Sequence PVIYLLNGGDGGEGAANWVMQTDVLDFYLEKNVNVVIPMEGKFSYYTDWVEENASLGGKQMWETFLVKEL
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP)


TTTTSSSSSS
TSS



TTSTTSB
SS
BGGGTB

BTTS
 .........150.........160.........170.........180.........190.........200.........210
Sequence PGPLEEKLNTDGQRAIAGMSMSATTSLLFPQHFPGFYDAAASFSGCAATSSLLPWEYLKLTLDRGNATPE
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP) T

S
TSTTT
SS

S

SSGGGT

 .........220.........230.........240.........250.........260.........270.........280
Sequence QMWGPRGGEYNIYNDALINSDKLRGTELYVSNASGETVVTGGIIEAATNKCTHDLKAKLDSAGIPADWNL
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP) SSTTST
TTTTGGGGTTS




T



 .........290.........300......
Sequence RPTHSWGWWQDDLRGSWTTFARAFEL
Predicted secondary structure







SS confidence

























Known secondary structure (DSSP)



TT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D