Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c4h05B_

Fold library idPDB HeaderMoleculeTitle
c4h05B_PDB header: transferaseChain: B: PDB Molecule: aminoglycoside-o-phosphotransferase viii;PDBTitle: crystal structure of aminoglycoside-3'-phosphotransferase of type viii


Added to library: Sat Apr 12 08:28:13 2014
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence HHHHMDDALRALRGRYPGCEWVVVEDGASGAGVYRLRGGGRELFVKVAALGAGVGLLGEAERLVWLAEVG
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP)

STT
S

GGG

SS

SSSSTT
 .........80.........90.........100.........110.........120.........130.........140
Sequence IPVPRVVEGGGDERVAWLVTEAVPGRPASARWPREQRLDVAVALAGLARSLHALDWERCPFDRSLAVTVP
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP)





SS



STTS


TS
GGG


B
S
 .........150.........160.........170.........180.........190.........200.........210
Sequence QAARAVAEGSVDLEDLDEERKGWSGERLLAELERTRPADEDLAVCHGDLCPDNVLLDPRTCEVTGLIDVG
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) TT
S
SSSS
TTTTT

T

S



S


GGG
TTT




T
 .........220.........230.........240.........250.........260.........270.
Sequence RVGRADRHSDLALVLRELAHEEDPWFGPECSAAFLREYGRGWDGAVSEEKLAFYRLLDEFF
Predicted secondary structure
























SS confidence




























































Known secondary structure (DSSP) T
TT
SSSS


T
S



TT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D