Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c4glpA_

Fold library idPDB HeaderMoleculeTitle
c4glpA_PDB header: immune systemChain: A: PDB Molecule: monocyte differentiation antigen cd14;PDBTitle: the crystal structure of soluble human cd14 reveals a bent solenoid2 with a hydrophobic amino-terminal pocket.


Added to library: Thu Jan 10 07:11:46 2013
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence ELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYADTVKALRVRRLT
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP)




SS






SSS

GGGGGGGTT
S


SS


SS


S
SS
S

SSSSGGGSS



 .........80.........90.........100.........110.........120.........130.........140
Sequence VGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQ
Predicted secondary structure












































SS confidence





































































Known secondary structure (DSSP)
S


BS


S


BS




SSS


B

SS
S


SSTTSS
 .........150.........160.........170.........180.........190.........200.........210
Sequence QWLKPGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMAALCPHKFPAIQNLALRNTGME
Predicted secondary structure

















































SS confidence





































































Known secondary structure (DSSP) TTB
S




SS



TTS



TT



S
TT
TTS
TTSS



S
B

SS


 .........220.........230.........240.........250.........260.........270.........280
Sequence TPTGVCAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLRVLDLS
Predicted secondary structure
























































SS confidence





































































Known secondary structure (DSSP)
T


SS
TTS






S

SS



TT




SS


S

S


S

S


 .........290.........300.........310
Sequence SNRLNRAPQPDELPEVDNLTLDGNPFLVPG
Predicted secondary structure






















SS confidence





























Known secondary structure (DSSP) S



S


TTS



S

SSTTTS



Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D