Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c4gdxB_

Fold library idPDB HeaderMoleculeTitle
c4gdxB_PDB header: hydrolaseChain: B: PDB Molecule: gamma-glutamyltranspeptidase 1 light chain;PDBTitle: crystal structure of human gamma-glutamyl transpeptidase--glutamate2 complex


Added to library: Sat Sep 28 08:24:39 2013
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence TAHLSVVAEDGSAVSATSTINLYFGSKVRSPVSGILFNNEMDDFSSPSITNEFGVPPSPANFIQPGKQPL
Predicted secondary structure


















































SS confidence





































































Known secondary structure (DSSP)

TTS


SSTTTTS
B
TTT

B


GGGGSB
TT


STT



GGGB

TT



 .........80.........90.........100.........110.........120.........130.........140
Sequence SSMCPTIMVGQDGQVRMVVGAAGGTQITTATALAIIYNLWFGYDVKRAVEEPRLHNQLLPNVTTVERNID
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP)





TTS
SSSSTS


S



SSSS

TTS
 .........150.........160.........170.........180.........190
Sequence QAVTAALETRHHHTQIASTFIAVVQAIVRTAGGWAAASDSRKGGEPAGYE
Predicted secondary structure





















SS confidence

















































Known secondary structure (DSSP) TT


SS


TT

TTTT







Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D