Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c4gdxB_

Fold library idPDB HeaderMoleculeTitle
c4gdxB_PDB header: hydrolaseChain: B: PDB Molecule: gamma-glutamyltranspeptidase 1 light chain;PDBTitle: crystal structure of human gamma-glutamyl transpeptidase--glutamate2 complex


Added to library: Sat Sep 28 08:24:39 2013
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence TAHLSVVAEDGSAVSATSTINLYFGSKVRSPVSGILFNNEMDDFSSPSITNEFGVPPSPANFIQPGKQPL
Predicted secondary structure


















































SS confidence





































































Known secondary structure (DSSP)

TTS


SSTTTTS
B
TTT

B


GGGGSB
TT


STT



GGGB

TT



 .........80.........90.........100.........110.........120.........130.........140
Sequence SSMCPTIMVGQDGQVRMVVGAAGGTQITTATALAIIYNLWFGYDVKRAVEEPRLHNQLLPNVTTVERNID
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP)





TTS
SSSSTS


S



SSSS

TTS
 .........150.........160.........170.........180.........190
Sequence QAVTAALETRHHHTQIASTFIAVVQAIVRTAGGWAAASDSRKGGEPAGYE
Predicted secondary structure





















SS confidence

















































Known secondary structure (DSSP) TT


SS


TT

TTTT







Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D