Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c4gdgA_

Fold library idPDB HeaderMoleculeTitle
c4gdgA_PDB header: hydrolaseChain: A: PDB Molecule: 3'(2'),5'-bisphosphate nucleotidase, putative;PDBTitle: structural and functional characterization of 3'(2'),5'-bisphosphate2 nucleotidase1 from entamoeba histolytica


Added to library: Sat Aug 3 08:31:22 2013
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MSFDKELALALEIVQVSCKITTSVAEHTLTDQTQIKNDKSPVTVGDYSVQAYVNKKIHETFPEDQIVAEE
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP)


TS
SGGG
TTS

TT
S
 .........80.........90.........100.........110.........120.........130.........140
Sequence DTKTIPEDIFAKVCKHVQIYSDMKDDEIRKSIDLGNSTGGKGRHWVLDPIDGTLGFLRREQYAVCLAFMI
Predicted secondary structure














































SS confidence





































































Known secondary structure (DSSP)
STT

TT



TTB


SSS
TTS

 .........150.........160.........170.........180.........190.........200.........210
Sequence DGDIKVGVLGCPNFEGGLIVAAQKGCGAKMFSVNDIKNGKDIHVSTTPKTSDMCFCESVEVSHTDQSRSK
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP) TTTTSTT
TTS
TT






GGG


SSTTTS
 .........220.........230.........240.........250.........260.........270.........280
Sequence TITERLQVTKPPVRMDSQCKYMAIASGRADVYLRLPRNLSYQEKIWDHAAGYLIVKEAGGKVTDIYGNDL
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP) TT

S



STTS
S

SSSS


BGGGTTT

TTS
B
 .........290.........300.........310.......
Sequence DFSLGRTLCNNHGIVASNGILHEETVNVVKDVLSDLK
Predicted secondary structure















SS confidence




































Known secondary structure (DSSP)
TTSSSB
TT

S
STTTTT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D