Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c4gd3B_

Fold library idPDB HeaderMoleculeTitle
c4gd3B_PDB header: oxidoreductase/electron transportChain: B: PDB Molecule: ni/fe-hydrogenase 1 b-type cytochrome subunit;PDBTitle: structure of e. coli hydrogenase-1 in complex with cytochrome b


Added to library: Thu Jan 10 06:56:07 2013
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence VVSHYVFEAPVRIWHWLTVLCMAVLMVTGYFIGKPLPSVSGEATYLFYMGYIRLIHFSAGMVFTVVLLMR
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP)









TTS





S
GGG

 .........80.........90.........100.........110.........120.........130.........140
Sequence IYWAFVGNRYSRQGVWYEIRWYLFLPIAQAAMFGYFLMSVFMIITGFALYSEHSQYAIFAPFRYVVEFFY
Predicted secondary structure












SS confidence





































































Known secondary structure (DSSP) TTTT
S



STTTSSSSS




TTTTTTT

SS
GGG
 .........150.........160.........170.........
Sequence WTGGNSMDIHSWHRLGMWLIGAFVIGHVYMALREDIMSD
Predicted secondary structure



SS confidence






































Known secondary structure (DSSP) TS
T



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D