Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c4g8kA_

Fold library idPDB HeaderMoleculeTitle
c4g8kA_PDB header: hydrolaseChain: A: PDB Molecule: 2-5a-dependent ribonuclease;PDBTitle: intact sensor domain of human rnase l in the inactive signaling state


Added to library: Sat Nov 3 16:52:24 2012
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence AAVEDNHLLIKAVQNEDVDLVQQLLEGGANVNFQEEEGGWTPLHNAVQMSREDIVELLLRHGADPVLRKK
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP)
TT
T

TT


TTT


TT
TT

TT


T
 .........80.........90.........100.........110.........120.........130.........140
Sequence NGATPFILAAIAGSVKLLKLFLSKGADVNECDFYGFTAFMEAAVYGKVKALKFLYKRGANVNLRRKTKLR
Predicted secondary structure

































































SS confidence





































































Known secondary structure (DSSP) T


T
TTT

TT
B
TT

BTT
TT

TT






T
 .........150.........160.........170.........180.........190.........200.........210
Sequence KGGATALMDAAEKGHVEVLKILLDEMGADVNACDNMGRNALIHALLSSDDSDVEAITHLLLDHGADVNVR
Predicted secondary structure





































































SS confidence





































































Known secondary structure (DSSP) T
S

T
S


TT


TTS

S
TTTTT

TT

 .........220.........230.........240.........250.........260.........270.........280
Sequence GERGKTPLILAVEKKHLGLVQRLLEQEHIEINDTDSDGKTALLLAVELKLKKIAELLCKRGASTDCGDLV
Predicted secondary structure



















































SS confidence





































































Known secondary structure (DSSP)
GGG

TT
TSTT

TT
B
TTS
BTT
TTS
SSTT

 .........290.........300..
Sequence MTARRNYDHSLVKVLLSHGAKE
Predicted secondary structure







SS confidence





















Known secondary structure (DSSP) TT
TT



Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D