Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c4g8aB_

Fold library idPDB HeaderMoleculeTitle
c4g8aB_PDB header: immune systemChain: B: PDB Molecule: toll-like receptor 4;PDBTitle: crystal structure of human tlr4 polymorphic variant d299g and t399i in2 complex with md-2 and lps


Added to library: Sat Oct 20 17:22:39 2012
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence PESWEPCVEVVPNITYQCMELNFYKIPDNLPFSTKNLDLSFNPLRHLGSYSFFSFPELQVLDLSRCEIQT
Predicted secondary structure



















































SS confidence





































































Known secondary structure (DSSP)

TTTTSTTT

SS

SS

S
S
TT



S




TTTTTT
TT
S
TT



 .........80.........90.........100.........110.........120.........130.........140
Sequence IEDGAYQSLSHLSTLILTGNPIQSLALGAFSGLSSLQKLVAVETNLASLENFPIGHLKTLKELNVAHNLI
Predicted secondary structure




















































SS confidence





































































Known secondary structure (DSSP)
TTTTTT
TT


TT


S
TTTTTT
TT


TTS



STT
S
TT
TT



SS

 .........150.........160.........170.........180.........190.........200.........210
Sequence QSFKLPEYFSNLTNLEHLDLSSNKIQSIYCTDLRVLHQMPLLNLSLDLSLNPMNFIQPGAFKEIRLHKLT
Predicted secondary structure





































































SS confidence





































































Known secondary structure (DSSP)





GGGGT
TT



SS



GGGGGGGGG






TT




TTTTTT
 .........220.........230.........240.........250.........260.........270.........280
Sequence LRNNFDSLNVMKTCIQGLAGLEVHRLVLGEFRNEGNLEKFDKSALEGLCNLTIEEFRLAYLDYYLDGIID
Predicted secondary structure





































































SS confidence





































































Known secondary structure (DSSP) S

SSTTTT


TTS


S


TTTTGGGGGS

SS

TT
 .........290.........300.........310.........320.........330.........340.........350
Sequence LFNCLTNVSSFSLVSVTIERVKDFSYNFGWQHLELVNCKFGQFPTLKLKSLKRLTFTSNKGGNAFSEVDL
Predicted secondary structure





































































SS confidence





































































Known secondary structure (DSSP) TTGGGTT
SS

GGGGS



SS
SS



B
TT

S


B



B
 .........360.........370.........380.........390.........400.........410.........420
Sequence PSLEFLDLSRNGLSFKGCCSQSDFGTISLKYLDLSFNGVITMSSNFLGLEQLEHLDFQHSNLKQMSEFSV
Predicted secondary structure


































































SS confidence





































































Known secondary structure (DSSP) TT



SS

B
ST
S




S
S
S

TT
TT


TTSSTTSS
T
 .........430.........440.........450.........460.........470.........480.........490
Sequence FLSLRNLIYLDISHTHTRVAFNGIFNGLSSLEVLKMAGNSFQENFLPDIFTELRNLTFLDLSQCQLEQLS
Predicted secondary structure


































































SS confidence





































































Known secondary structure (DSSP) TTT
TT


TTS



TTTTTT
TT


TT
GGG
S

TT
TT


TTS



 .........500.........510.........520.........530.........540.........550.........560
Sequence PTAFNSLSSLQVLNMSHNNFFSLDTFPYKCLNSLQVLDYSLNHIMTSKKQELQHFPSSLAFLNLTQNDFA
Predicted secondary structure












































SS confidence





































































Known secondary structure (DSSP) TTTTTT
TT



SS

SB


GGGTT
TT


TTS


B

TGGGS


TT



S

 .........570.........580.........590.........600.....
Sequence CTCEHQSFLQWIKDQRQLLVEVERMECATPSDKQGMPVLSLNITC
Predicted secondary structure





















SS confidence












































Known secondary structure (DSSP)
SGGGTTTTBS
GGG
BSTTTTT
BSTT





Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D