Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c4g84B_

Fold library idPDB HeaderMoleculeTitle
c4g84B_PDB header: ligaseChain: B: PDB Molecule: histidine--trna ligase, cytoplasmic;PDBTitle: crystal structure of human hisrs


Added to library: Sat Sep 29 15:26:07 2012
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence GPGSEFELRRQFVLKTPKGTRDYSPRQMAVREKVFDVIIRCFKRHGAEVIDTPVFELKETLMSKLIYDLK
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP)




S

TT




TT




S

TTS
B

 .........80.........90.........100.........110.........120.........130.........140
Sequence DQGGELLSLRYDLTVPFARYLAMNKLTNIKRYHIAKVYRRDNRYREFYQCDFDIAGNFDPMIPDAECLKI
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP)

SS


S
STT
S






SS

STT
 .........150.........160.........170.........180.........190.........200.........210
Sequence MCEILSSLQIGDFLVKVNDRRILDGMFAICGVSDSKFRTICSSVDKLDKVSWEEVKNEMVGEKGLAPEVA
Predicted secondary structure

















SS confidence





































































Known secondary structure (DSSP) TT
S
TT

GGGGGGGTS
TTT


 .........220.........230.........240.........250.........260.........270.........280
Sequence DRIGDYVQQHGGVSLVEQLLQDPKLSQNKQALEGLGDLKLLFEYLTLFGIDDKISFDLSLARGLDYYTGV
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) T
SS
TTGGG
TT
GGGTT



TTT
SS
 .........290.........300.........310.........320.........330.........340.........350
Sequence IYEAVLLQGSVAAGGRYDGLVGMFDPKGRKVPCVGLSIGVERIFSIVEQRLEALEEKIRTTETQVLVASA
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP)



SSSTT





TT



S




S
 .........360.........370.........380.........390.........400.........410.........420
Sequence QKKLLEERLKLVSELWDAGIKAELLYKKNPKLLNQLQYCEEAGIPLVAIIGEQELKDGVIKLRSVTSREE
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP) SSS
TT



S
SS

T



TTTTT

 .........430........
Sequence VDVRREDLVEEIKRRTGQ
Predicted secondary structure


SS confidence

















Known secondary structure (DSSP) GGG


Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D