Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c4fzhD_

Fold library idPDB HeaderMoleculeTitle
c4fzhD_PDB header: hydrolaseChain: D: PDB Molecule: hemagglutinin-neuraminidase;PDBTitle: structure of the ulster strain newcastle disease virus hemagglutinin-2 neuraminidase reveals auto-inhibitory interactions associated with3 low virulence


Added to library: Thu Jan 10 02:02:21 2013
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence GAPIHDPDYIGGIGKELIVDDASDVTSFYPSAFQEHLNFIPAPTTGSGCTRIPSFDMSATHYCYTHNVIL
Predicted secondary structure









































SS confidence





































































Known secondary structure (DSSP)





TTTTTSSSS


SSS
GGG
S






S



SSSS
SS
S
 .........80.........90.........100.........110.........120.........130.........140
Sequence SGCRDHSHSHQYLALGVLRTSATGRVFFSTLHSINLDDTQNRKSCSVSATPLGCDMLCSKVTETEEEDYN
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP) SSS
TTS

TT


SSS

TT
SS
S
 .........150.........160.........170.........180.........190.........200.........210
Sequence SAVPTSMVHGRLGFDGQYHEKDLDVTTLFEDWVANYPGVGGGSFIDNRVWFPVYGGLKPNSPSDTAQEGK
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP)

S


TT



TT
BS

TT
TT
TTTTTSTT
 .........220.........230.........240.........250.........260.........270.........280
Sequence YVIYKRYNDTCPDEQDYQIRMAKSSYKPGRFGGKRVQQAILSIKVSTSLGEDPVLTVPPNTVTLMGAEGR
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP)





SSS


S
TTS
GGGTS

SSSTT


TTTS
S


 .........290.........300.........310.........320.........330.........340.........350
Sequence VLTVGTSHFLYQRGSSYFSPALLYPMTVSNKTATLHSPYTFDAFTRPGSVPCQASARCPNSCVTGVYTDP
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP) TT
S
SS

STT
S
SS





SSSSTT

S









 .........360.........370.........380.........390.........400.........410.........420
Sequence YPLVFYRNHTLRGVFGTMLDDKQARLNPVSAVFDSISRSRITRVSSSSTKAAYTTSTCFKVVKTNKTYCL
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP)
SSS


SSSSB

SS
B


SSSS

BTTTT
 .........430.........440.........450.........460.........470.........480......
Sequence SIAEISNTLFGEFRIVPLLVEILKDDGVRLSQLREGWKDDIVSPIFCDAKNQTEYRRELESYAASW
Predicted secondary structure

















SS confidence

































































Known secondary structure (DSSP)

STTTS






S

SSS




SS
SSS


TTS




Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D