Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c4fzhD_

Fold library idPDB HeaderMoleculeTitle
c4fzhD_PDB header: hydrolaseChain: D: PDB Molecule: hemagglutinin-neuraminidase;PDBTitle: structure of the ulster strain newcastle disease virus hemagglutinin-2 neuraminidase reveals auto-inhibitory interactions associated with3 low virulence


Added to library: Thu Jan 10 02:02:21 2013
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence GAPIHDPDYIGGIGKELIVDDASDVTSFYPSAFQEHLNFIPAPTTGSGCTRIPSFDMSATHYCYTHNVIL
Predicted secondary structure









































SS confidence





































































Known secondary structure (DSSP)





TTTTTSSSS


SSS
GGG
S






S



SSSS
SS
S
 .........80.........90.........100.........110.........120.........130.........140
Sequence SGCRDHSHSHQYLALGVLRTSATGRVFFSTLHSINLDDTQNRKSCSVSATPLGCDMLCSKVTETEEEDYN
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP) SSS
TTS

TT


SSS

TT
SS
S
 .........150.........160.........170.........180.........190.........200.........210
Sequence SAVPTSMVHGRLGFDGQYHEKDLDVTTLFEDWVANYPGVGGGSFIDNRVWFPVYGGLKPNSPSDTAQEGK
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP)

S


TT



TT
BS

TT
TT
TTTTTSTT
 .........220.........230.........240.........250.........260.........270.........280
Sequence YVIYKRYNDTCPDEQDYQIRMAKSSYKPGRFGGKRVQQAILSIKVSTSLGEDPVLTVPPNTVTLMGAEGR
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP)





SSS


S
TTS
GGGTS

SSSTT


TTTS
S


 .........290.........300.........310.........320.........330.........340.........350
Sequence VLTVGTSHFLYQRGSSYFSPALLYPMTVSNKTATLHSPYTFDAFTRPGSVPCQASARCPNSCVTGVYTDP
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP) TT
S
SS

STT
S
SS





SSSSTT

S









 .........360.........370.........380.........390.........400.........410.........420
Sequence YPLVFYRNHTLRGVFGTMLDDKQARLNPVSAVFDSISRSRITRVSSSSTKAAYTTSTCFKVVKTNKTYCL
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP)
SSS


SSSSB

SS
B


SSSS

BTTTT
 .........430.........440.........450.........460.........470.........480......
Sequence SIAEISNTLFGEFRIVPLLVEILKDDGVRLSQLREGWKDDIVSPIFCDAKNQTEYRRELESYAASW
Predicted secondary structure

















SS confidence

































































Known secondary structure (DSSP)

STTTS






S

SSS




SS
SSS


TTS




Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D