Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c4fnvA_

Fold library idPDB HeaderMoleculeTitle
c4fnvA_PDB header: lyaseChain: A: PDB Molecule: heparinase iii protein, heparitin sulfate lyase;PDBTitle: crystal structure of heparinase iii


Added to library: Wed Jan 9 15:17:36 2013
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence VVDPQVFEAINLNYPGLEKVKEFYEAGEHYYAANALLEYYRTRTNVTNPNLSLINVTISEAEQAKADYAL
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP)


TB
TTSTT
TT


S


TT


SS



TT
 .........80.........90.........100.........110.........120.........130.........140
Sequence VDYRFHVNNFYEDKETLKPYSVKQDGGINWEYSPKDASDEYQKQLHRHQWFIPQAKAYRVSGDEKYIQSW
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP) STTB

BTTB
SBGGGTB

B
TT
TT


TT

TTTTT

T
 .........150.........160.........170.........180.........190.........200.........210
Sequence IEVYKNWIENNPKPTTGPNTTSWWQLQVSTRIGDQVQLLEYFKNSVNFTPEWLSTFLVEFAEQADFLVDY
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP)



SSS

SSTT
TTSTTS

 .........220.........230.........240.........250.........260.........270.........280
Sequence PYESGGNILISQANALATAGTLMPEFKNAEKWMNTGYQILSEEVQNQIMSDGWHKEMSLHYHIGIVADFY
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP)

TT

TTBTTSB
TTS
BTT

 .........290.........300.........310.........320.........330.........340.........350
Sequence EAMKLAEANQLSSKLPSDFTEPLRKAAEVVMYFTYPNYFIKGSDNVVPMFNDSWSRTRNVLKNTNFKQYV
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP) TT
GGGS
TTTTTS
GGGGS

SS

S


SS




T
 .........360.........370.........380.........390.........400.........410.........420
Sequence EMFPDSEELKYMQTAGNGGTAQGRTPNNDMKLFDQAGYYVLRNGWTPASTVMILSNNKSNDASNSLSAYS
Predicted secondary structure
















































SS confidence





































































Known secondary structure (DSSP)
TT
GGG



S



S

TTTTS
SSTT


B
BTTB


STT
 .........430.........440.........450.........460.........470.........480.........490
Sequence HNQPDNGTFELYHNGRNFFPDSGVCTYYTSGGDNDLRYWFRGIDKHNTLSIGKQNIKKAAGKLLKSEEGA
Predicted secondary structure














































SS confidence





































































Known secondary structure (DSSP) SS
S
TT
TTSS


B





TTS


GGGSSSTT


S

B

SS
 .........500.........510.........520.........530.........540.........550.........560
Sequence TELVVFENQGYDNLKHRRAVFYVNKKFFVLVDEGIGNAEGTINLSFNLCEGTASEVVMDTDKNGVHTAFS
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP) STTTTTSS






TTTGGGT

T
 .........570.........580.........590.........600.........610.........620.........630
Sequence NNNNIIVRTFANKAVTCSPFTGRIAYLVDGAYNTRQSYTIDMNKSADETARYITVILPVNGSTDTSSISA
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP) T
SS

BSSSSS


TT

S

TT

 .........640.........650.........
Sequence KFIDSGYSENSASVEVSVNGETHTLSYTL
Predicted secondary structure












SS confidence




























Known secondary structure (DSSP)
SSS
BTTTT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D