Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c4fneA_

Fold library idPDB HeaderMoleculeTitle
c4fneA_PDB header: steroid-binding proteinChain: A: PDB Molecule: steroid receptor 2;PDBTitle: x-ray crystal structure of the ancestral 3-keto steroid receptor - doc2 complex


Added to library: Wed Jan 9 16:48:15 2013
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence NAPSLISILQAIEPEVVYAGYDNTQPDTTNYLLSSLNRLAEKQLVSVVKWAKALPGFRNLHLDDQMTLIQ
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP)



S









SSS


STTGGGS
 .........80.........90.........100.........110.........120.........130.........140
Sequence YSWMGLMAFAMGWRSYKHTNGQMLYFAPDLIFNEQRMQQSAMYDLCQGMQQISQEFVRLQVTQEEFLCMK
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP) TTSSTT
TT
T

 .........150.........160.........170.........180.........190.........200.........210
Sequence ALLLLSTVPKEGLKSQASFDEMRMNYIKELNRAIAKKENNSAQNWQRFYQLTKLLDSMHDLVGGLLQFCF
Predicted secondary structure
















SS confidence





































































Known secondary structure (DSSP) TTTT

TTTT


 .........220.........230.........240........
Sequence YTFVQSQALSVEFPEMLVEIISAQLPKVLAGMAKPLLF
Predicted secondary structure



















SS confidence





































Known secondary structure (DSSP) TT



TT




Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D