Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c4fneA_

Fold library idPDB HeaderMoleculeTitle
c4fneA_PDB header: steroid-binding proteinChain: A: PDB Molecule: steroid receptor 2;PDBTitle: x-ray crystal structure of the ancestral 3-keto steroid receptor - doc2 complex


Added to library: Wed Jan 9 16:48:15 2013
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence NAPSLISILQAIEPEVVYAGYDNTQPDTTNYLLSSLNRLAEKQLVSVVKWAKALPGFRNLHLDDQMTLIQ
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP)



S









SSS


STTGGGS
 .........80.........90.........100.........110.........120.........130.........140
Sequence YSWMGLMAFAMGWRSYKHTNGQMLYFAPDLIFNEQRMQQSAMYDLCQGMQQISQEFVRLQVTQEEFLCMK
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP) TTSSTT
TT
T

 .........150.........160.........170.........180.........190.........200.........210
Sequence ALLLLSTVPKEGLKSQASFDEMRMNYIKELNRAIAKKENNSAQNWQRFYQLTKLLDSMHDLVGGLLQFCF
Predicted secondary structure
















SS confidence





































































Known secondary structure (DSSP) TTTT

TTTT


 .........220.........230.........240........
Sequence YTFVQSQALSVEFPEMLVEIISAQLPKVLAGMAKPLLF
Predicted secondary structure



















SS confidence





































Known secondary structure (DSSP) TT



TT




Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D