Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c4fmzA_

Fold library idPDB HeaderMoleculeTitle
c4fmzA_PDB header: cell adhesion, cell invasionChain: A: PDB Molecule: internalin;PDBTitle: crystal structure of an internalin (inlf) from listeria monocytogenes2 str. 4b f2365 at 1.91 a resolution


Added to library: Sat Aug 4 14:03:19 2012
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence TLATLPAPINQIFPDADLAEGIRAVLQKASVTDVVTQEELESITKLVVAGEKVASIQGIEYLTNLEYLNL
Predicted secondary structure











































SS confidence





































































Known secondary structure (DSSP) undefined
 .........80.........90.........100.........110.........120.........130.........140
Sequence NGNQITDISPLSNLVKLTNLYIGTNKITDISALQNLTNLRELYLNEDNISDISPLANLTKXYSLNLGANH
Predicted secondary structure

































































SS confidence





































































Known secondary structure (DSSP)
 .........150.........160.........170.........180.........190.........200.........210
Sequence NLSDLSPLSNXTGLNYLTVTESKVKDVTPIANLTDLYSLSLNYNQIEDISPLASLTSLHYFTAYVNQITD
Predicted secondary structure





































































SS confidence





































































Known secondary structure (DSSP)
 .........220.........230.........240.........250.........260.........270.........280
Sequence ITPVANXTRLNSLKIGNNKITDLSPLANLSQLTWLEIGTNQISDINAVKDLTKLKXLNVGSNQISDISVL
Predicted secondary structure


































































SS confidence





































































Known secondary structure (DSSP)
 .........290.........300.........310.........320.........330.........340
Sequence NNLSQLNSLFLNNNQLGNEDXEVIGGLTNLTTLFLSQNHITDIRPLASLSKXDSADFANQ
Predicted secondary structure















































SS confidence



























































Known secondary structure (DSSP)


Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D