Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c4fcgA_

Fold library idPDB HeaderMoleculeTitle
c4fcgA_PDB header: structural genomics, unknown functionChain: A: PDB Molecule: uncharacterized protein;PDBTitle: structure of the leucine-rich repeat domain of the type iii effector2 xcv3220 (xopl)


Added to library: Sat Jun 16 14:05:27 2012
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence LYFQTALRPYHDVLSQWQRHYNADRNRWHSAWRQANSNNPQIETRTGRALKATADLLEDATQPGRVALEL
Predicted secondary structure












































SS confidence





































































Known secondary structure (DSSP)










TTTTT
TTS

STSTT

 .........80.........90.........100.........110.........120.........130.........140
Sequence RSVPLPQFPDQAFRLSHLQHXTIDAAGLXELPDTXQQFAGLETLTLARNPLRALPASIASLNRLRELSIR
Predicted secondary structure


























































SS confidence





































































Known secondary structure (DSSP) SS

SS

S
GGGGTT
SSS





S
GGGGTT
SS






GGGGG
TT

 .........150.........160.........170.........180.........190.........200.........210
Sequence ACPELTELPEPLASTDSGEHQGLVNLQSLRLEWTGIRSLPASIANLQNLKSLKIRNSPLSALGPAIHHLP
Predicted secondary structure





































































SS confidence





































































Known secondary structure (DSSP) TT




S
S



STT







GGGGG
TT

SS





GGGGG
T
 .........220.........230.........240.........250.........260.........270.........280
Sequence KLEELDLRGCTALRNYPPIFGGRAPLKRLILKDCSNLLTLPLDIHRLTQLEKLDLRGCVNLSRLPSLIAQ
Predicted secondary structure




















































SS confidence





































































Known secondary structure (DSSP) T


TT
TT

B



TT






TT
TT

B

TTGGG
TT


TT
TT




GGGGG
 .........290......
Sequence LPANCIILVPPHLQAQ
Predicted secondary structure









SS confidence















Known secondary structure (DSSP) S
TT


GGGS


Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D