Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c4ezgB_

Fold library idPDB HeaderMoleculeTitle
c4ezgB_PDB header: cell adhesionChain: B: PDB Molecule: putative uncharacterized protein;PDBTitle: crystal structure of a leucine rich hypothetical protein2 (lmof2365_1307) from listeria monocytogenes str. li 2 at 1.50 a3 resolution


Added to library: Sat Jun 30 13:47:44 2012
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence ASQDNVNIPDSTFKAYLNGLLGQSSTANITEAQXNSLTYITLANINVTDLTGIEYAHNIKDLTINNIHAT
Predicted secondary structure













































SS confidence





































































Known secondary structure (DSSP)
TTSB




TT

TT


BT

SS

S

TTGGG
TT

S


S
 .........80.........90.........100.........110.........120.........130.........140
Sequence NYNPISGLSNLERLRIXGKDVTSDKIPNLSGLTSLTLLDISHSAHDDSILTKINTLPKVNSIDLSYNGAI
Predicted secondary structure


































































SS confidence





































































Known secondary structure (DSSP)

GGGTT
TT


TT
BGGGS


TT
TT



SSB
BGGGTT
SS



S
TB
 .........150.........160.........170.........180..
Sequence TDIXPLKTLPELKSLNIQFDGVHDYRGIEDFPKLNQLYAFSQ
Predicted secondary structure



























SS confidence









































Known secondary structure (DSSP)


GGGGG
SS


TTSS



TTGGG
SS






Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D