Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c4ecoA_

Fold library idPDB HeaderMoleculeTitle
c4ecoA_PDB header: unknown functionChain: A: PDB Molecule: uncharacterized protein;PDBTitle: crystal structure of a hypothetical protein (bacegg_03329) from2 bacteroides eggerthii dsm 20697 at 2.70 a resolution


Added to library: Sat May 26 12:46:18 2012
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence TVKDNDAIVPIKLSRTAEYIKDYLALKEIWDALNGKNWSQQGANWNFNKELDXWGAQPGVSLNSNGRVTG
Predicted secondary structure















































SS confidence





































































Known secondary structure (DSSP)










TTGGG









SS
GGGTT

TT
TT

 .........80.........90.........100.........110.........120.........130.........140
Sequence LSLEGFGASGRVPDAIGQLTELEVLALGSHGEKVNERLFGPKGISANXSDEQKQKXRXHYQKTFVDYDPR
Predicted secondary structure

















































SS confidence





































































Known secondary structure (DSSP)
TTS


GGGGG
TT

S

GGGGGT

SBSTTSB
TT

TT


GG
 .........150.........160.........170.........180.........190.........200.........210
Sequence EDFSDLIKDCINSDPQQKSIKKSSRITLKDTQIGQLSNNITFVSKAVXRLTKLRQFYXGNSPFVAENICE
Predicted secondary structure


















































SS confidence





































































Known secondary structure (DSSP) GGS

TTS











TTTTT

S

GGGGG
TT

S



GGGBSS
 .........220.........230.........240.........250.........260.........270.........280
Sequence AWENENSEYAQQYKTEDLKWDNLKDLTDVEVYNCPNLTKLPTFLKALPEXQLINVACNRGISGEQLKDDW
Predicted secondary structure




















































SS confidence





































































Known secondary structure (DSSP) S
S
TTSTTS


GGG
TT



TT
SS

TTTTT
SS


TT
TTS
 .........290.........300.........310.........320.........330.........340.........350
Sequence QALADAPVGEKIQIIYIGYNNLKTFPVETSLQKXKKLGXLECLYNQLEGKLPAFGSEIKLASLNLAYNQI
Predicted secondary structure




























































SS confidence





































































Known secondary structure (DSSP) SGGGGT



SS

SS


TT
TT



S






S

SS
 .........360.........370.........380.........390.........400.........410.........420
Sequence TEIPANFCGFTEQVENLSFAHNKLKYIPNIFDAKSVSVXSAIDFSYNEIGSVDGKNFDPLDPTPFKGINV
Predicted secondary structure























































SS confidence





































































Known secondary structure (DSSP)

TTS
TT



SS

SS

S


TT
SS


SS
TTTTTT
SS
TT
SS





 .........430.........440.........450.........460.........470.........480.........490
Sequence SSINLSNNQISKFPKELFSTGSPLSSINLXGNXLTEIPKNSLKDENENFKNTYLLTSIDLRFNKLTKLSD
Predicted secondary structure


















































SS confidence





































































Known secondary structure (DSSP)

SS


S

TTT


S

SS

SB

SSSSTT
TTGGG



SS


B

G
 .........500.........510.........520.........530.........540.........550.........560
Sequence DFRATTLPYLVGIDLSYNSFSKFPTQPLNSSTLKGFGIRNQRDAQGNRTLREWPEGITLCPSLTQLQIGS
Predicted secondary structure


















































SS confidence





































































Known secondary structure (DSSP) GGSTTT
TT



SS

SS


GGGG
SS



S
B
TT

B





TTGGG
SS



S
 .........570.........580.........590.........600.........610.........620
Sequence NDIRKVNEKITPNISVLDIKDNPNISIDLSYVCPYIEAGXYXLFYDKTQDIRGCDALDIK
Predicted secondary structure


































SS confidence



























































Known secondary structure (DSSP) S


B

S


TT



S
TT

TTTTT



TTSS
GGG



Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D