Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c4ecnA_

Fold library idPDB HeaderMoleculeTitle
c4ecnA_PDB header: unknown functionChain: A: PDB Molecule: leucine-rich repeat protein;PDBTitle: crystal structure of a leucine-rich repeat protein (bt_0210) from2 bacteroides thetaiotaomicron vpi-5482 at 2.80 a resolution


Added to library: Sat May 26 12:52:48 2012
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence SQYGYVQFKLYKSTSXSSAQKIKVVXTHNGTTVSQTLLLNAYNANNAEYGLRSDKLQLLAGTYKIVGYYL
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP)










SSS




SS

S
 .........80.........90.........100.........110.........120.........130.........140
Sequence YDGLDEVLLAGPAGDDNELTVVSGGLLEKALTVDAVPHGTVTFKLSKEGISTRAAGEYLFSNIRYVDVTV
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP)
TT



S


TT


SS

SSTTSS

SS
STT

 .........150.........160.........170.........180.........190.........200.........210
Sequence XNSFNRVTTELKGXKVTYKEDIGVATCDSAVWLPAGTYQVVAYTTYSQSGIKRSELETQSVRGESFTVID
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP) TTT







STT





T
 .........220.........230.........240.........250.........260.........270.........280
Sequence NKLTKDANVPIQLKETAEYIKDYKALKAIWEALDGKNWRYYSGTINNTIHSLNWNFNKELDXWGDQPGVD
Predicted secondary structure








































SS confidence





































































Known secondary structure (DSSP) TS





TTGGG




SS
SS




S


SS
GGGTT

TT
 .........290.........300.........310.........320.........330.........340.........350
Sequence LDNNGRVTGLSLAGFGAKGRVPDAIGQLTELKVLSFGTHSETVSGRLFGDEELTPDXSEERKHRIRXHYK
Predicted secondary structure


















































SS confidence





































































Known secondary structure (DSSP)
TTS

TTT


GGGGG
TT

S

TTTT
BTTB


SS

T
 .........360.........370.........380.........390.........400.........410.........420
Sequence KXFLDYDQRLNLSDLLQDAINRNPEXKPIKKDSRISLKDTQIGNLTNRITFISKAIQRLTKLQIIYFANS
Predicted secondary structure















































SS confidence





































































Known secondary structure (DSSP) T


GGGGS
T
TTS











TTTTT

S

GGGGG
TT

S
 .........430.........440.........450.........460.........470.........480.........490
Sequence PFTYDNIAVDWEDANSDYAKQYENEELSWSNLKDLTDVELYNCPNXTQLPDFLYDLPELQSLNIACNRGI
Predicted secondary structure















































SS confidence





































































Known secondary structure (DSSP)


GGGBSSS
S
TTSTTS


GGG
TT

S
TT

S

GGGGG
SS


TT
TTS
 .........500.........510.........520.........530.........540.........550.........560
Sequence SAAQLKADWTRLADDEDTGPKIQIFYXGYNNLEEFPASASLQKXVKLGLLDCVHNKVRHLEAFGTNVKLT
Predicted secondary structure





























































SS confidence





































































Known secondary structure (DSSP)

TTTTTT



SS


B


TT
TT


TTS


B




TTSS
 .........570.........580.........590.........600.........610.........620.........630
Sequence DLKLDYNQIEEIPEDFCAFTDQVEGLGFSHNKLKYIPNIFNAKSVYVXGSVDFSYNKIGSEGRNISCSXD
Predicted secondary structure
























































SS confidence





































































Known secondary structure (DSSP)

SS

S


TTS

TT



SS


S

S


TT
SS


SS
TTTTSSS
SS
TT
 .........640.........650.........660.........670.........680.........690.........700
Sequence DYKGINASTVTLSYNEIQKFPTELFATGSPISTIILSNNLXTSIPENSLKPKDGNYKNTYLLTTIDLRFN
Predicted secondary structure




















































SS confidence





































































Known secondary structure (DSSP) T






SS


S

TT


S

S


S


TTSSS
TTS

TTGGG



SS
 .........710.........720.........730.........740.........750.........760.........770
Sequence KLTSLSDDFRATTLPYLSNXDVSYNCFSSFPTQPLNSSQLKAFGIRHQRDAEGNRILRQWPTGITTCPSL
Predicted secondary structure























































SS confidence





































































Known secondary structure (DSSP)





GGGSTTT
TT



SS

SS


GGGG
TT





B
TT

B





TTGGG
SS
 .........780.........790.........800.........810.........820.........830........
Sequence IQLQIGSNDIRKVDEKLTPQLYILDIADNPNISIDVTSVCPYIEAGXYVLLYDKTQDIRGCDALGIER
Predicted secondary structure












































SS confidence



































































Known secondary structure (DSSP)


SS


B

S


SSS


S
TT

GGGTT



TTSS
GGG




Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D