Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c4dpkB_

Fold library idPDB HeaderMoleculeTitle
c4dpkB_PDB header: oxidoreductaseChain: B: PDB Molecule: malonyl-coa/succinyl-coa reductase;PDBTitle: structure of malonyl-coenzyme a reductase from crenarchaeota


Added to library: Wed Jan 9 14:48:43 2013
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence RTLKAAILGATGLVGIEYVRMLSNHPYIKPAYLAGKGSVGKPYGEVVRWQTVGQVPKEIADMEIKPTDPK
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP)

TTTTSTTTS
SSSTTTTSB



SSS


TTTTT
B


TT
 .........80.........90.........100.........110.........120.........130.........140
Sequence LMDDVDIIFSPLPQGAAGPVEEQFAKEGFPVISNSPDHRFDPDVPLLVPELNPHTISLIDEQRKRREWKG
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP) S
TT




TTTTTT

SSTTTT
TTS
B

TTT
GGGGGT
SS
 .........150.........160.........170.........180.........190.........200.........210
Sequence FIVTTPLCTAQGAAIPLGAIFKDYKMDGAFITTIQSLSGAGYPGIPSLDVVDNILPLGDGYDAKTIKEIF
Predicted secondary structure













































SS confidence





































































Known secondary structure (DSSP)


S
B
SGGG
SS
S
GGGTTTS


 .........220.........230.........240.........250.........260.........270.........280
Sequence RILSEVKRNVDEPKLEDVSLAATTHRIATIHGHYEVLYVSFKEETAAEKVKETLENFRGEPQDLKLPTAP
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP) T


S


S
GGG


S
SS
SS


T


T
TT

 .........290.........300.........310.........320.........330.........340.........350
Sequence SKPIIVMNEDTRPQVYFDRWAGDIPGMSVVVGRLKQVNKRMIRLVSLIHNTVRGAAGGGILAAELLVEKG
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP) S
S

STT


TT
TTTTT
STT
TTTTTTTT
 ....
Sequence YIEK
Predicted secondary structure



SS confidence



Known secondary structure (DSSP)
S


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D