Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c4dpkB_

Fold library idPDB HeaderMoleculeTitle
c4dpkB_PDB header: oxidoreductaseChain: B: PDB Molecule: malonyl-coa/succinyl-coa reductase;PDBTitle: structure of malonyl-coenzyme a reductase from crenarchaeota


Added to library: Wed Jan 9 14:48:43 2013
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence RTLKAAILGATGLVGIEYVRMLSNHPYIKPAYLAGKGSVGKPYGEVVRWQTVGQVPKEIADMEIKPTDPK
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP)

TTTTSTTTS
SSSTTTTSB



SSS


TTTTT
B


TT
 .........80.........90.........100.........110.........120.........130.........140
Sequence LMDDVDIIFSPLPQGAAGPVEEQFAKEGFPVISNSPDHRFDPDVPLLVPELNPHTISLIDEQRKRREWKG
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP) S
TT




TTTTTT

SSTTTT
TTS
B

TTT
GGGGGT
SS
 .........150.........160.........170.........180.........190.........200.........210
Sequence FIVTTPLCTAQGAAIPLGAIFKDYKMDGAFITTIQSLSGAGYPGIPSLDVVDNILPLGDGYDAKTIKEIF
Predicted secondary structure













































SS confidence





































































Known secondary structure (DSSP)


S
B
SGGG
SS
S
GGGTTTS


 .........220.........230.........240.........250.........260.........270.........280
Sequence RILSEVKRNVDEPKLEDVSLAATTHRIATIHGHYEVLYVSFKEETAAEKVKETLENFRGEPQDLKLPTAP
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP) T


S


S
GGG


S
SS
SS


T


T
TT

 .........290.........300.........310.........320.........330.........340.........350
Sequence SKPIIVMNEDTRPQVYFDRWAGDIPGMSVVVGRLKQVNKRMIRLVSLIHNTVRGAAGGGILAAELLVEKG
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP) S
S

STT


TT
TTTTT
STT
TTTTTTTT
 ....
Sequence YIEK
Predicted secondary structure



SS confidence



Known secondary structure (DSSP)
S


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D