Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c4djiA_

Fold library idPDB HeaderMoleculeTitle
c4djiA_PDB header: transport proteinChain: A: PDB Molecule: probable glutamate/gamma-aminobutyrate antiporter;PDBTitle: structure of glutamate-gaba antiporter gadc


Added to library: Sat Mar 17 12:11:00 2012
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence AKQLTLLGFFAITASMVMAVYEYPTFATSGFSLVFFLLLGGILWFIPVGLCAAEMATVDGWEEGGVFAWV
Predicted secondary structure










SS confidence





































































Known secondary structure (DSSP)




GGGS


TTSGGGSTTGGGTSBTTTSS
SSS
 .........80.........90.........100.........110.........120.........130.........140
Sequence SNTLGPRWGFAAISFGYLQIAIGFIPMLYFVLGALSYILKWPALNEDPITKTIAALIILWALALTQFGGT
Predicted secondary structure









SS confidence





































































Known secondary structure (DSSP) T
TTTTTT
TTTTS
S
T
 .........150.........160.........170.........180.........190.........200.........210
Sequence KYTARIAKVGFFAGILLPAFILIALAAIYLHSGAIEMDSKTFFPDFSKVGTLVVFVAFILSYMGVEASAT
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP) TSTTS





SS

S

TTSTTSGGGTTTTTTSG
 .........220.........230.........240.........250.........260.........270.........280
Sequence HVNEMSNPGRDYPLAMLLLMVAAICLSSVGGLSIAMVIPGNEINLSAGVMQTFTVLMSHVAPEIEWTVRV
Predicted secondary structure













SS confidence





































































Known secondary structure (DSSP) GGTTSS
S
GGG

SSS
GGGTT
 .........290.........300.........310.........320.........330.........340.........350
Sequence ISALLLLGVLAEIASWIVGPSRGMYVTAQKNLLPAAFAKMNKNGVPVTLVISQLVITSIALIILTNTGGG
Predicted secondary structure













SS confidence





































































Known secondary structure (DSSP) TTT
TS
S
SSS



SS


TTTTTTSSS
 .........360.........370.........380.........390.........400.........410.........420
Sequence NNMSFLIALALTVVIYLCAYFMLFIGYIVLVLKHPDLKRTFNIPGGKGVKLVVAIVGLLTSIMAFIVSFL
Predicted secondary structure














SS confidence





































































Known secondary structure (DSSP) S

SS
BSS

SS
TT
 .........430.........440.........450.........460.........470.........480.........490
Sequence PPDNIQGDSTDMYVELLVVSFLVVLALPFILYAVHDANTGVTLEPINSQNAPKGHFFLHPRARSPHYIVM
Predicted secondary structure











































SS confidence





































































Known secondary structure (DSSP)

S
SSSS

SSTTTT









SSS

TTSTTS
TTT

SSS
 ...
Sequence NDK
Predicted secondary structure


SS confidence


Known secondary structure (DSSP) S


Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D