Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c4d98A_

Fold library idPDB HeaderMoleculeTitle
c4d98A_PDB header: transferaseChain: A: PDB Molecule: purine nucleoside phosphorylase deod-type;PDBTitle: crystal structure of the hexameric purine nucleoside phosphorylase2 from bacillus subtilis in space group h32 at ph 7.5


Added to library: Wed Jan 9 23:08:33 2013
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence SVHIGAEKGQIADTVLLPGDPLRAKFIAETYLENVECYNEVRGMYGFTGTYKGKKISVQGTGMGVPSISI
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP)

S



TTSS
S
SS

GGG

TT


SS
 .........80.........90.........100.........110.........120.........130.........140
Sequence YVNELIQSYDVQNLIRVGSCGAIRKDVKVRDVILAMTSSTDSQMNRVAFGSVDFAPCADFELLKNAYDAA
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP)



STT

TT
S
STT







 .........150.........160.........170.........180.........190.........200.........210
Sequence KDKGVPVTVGSVFTADQFYNDDSQIEKLAKYGVLGVEMETTALYTLAAKHGRKALSILTVSDHVLTGEET
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) TT


S
SS
TT

TT

SSTT
TTT

B
 .........220.........230.
Sequence TAEERQTTFHDMIDVALHSVS
Predicted secondary structure

SS confidence




















Known secondary structure (DSSP)
TS


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D