Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c4d98A_

Fold library idPDB HeaderMoleculeTitle
c4d98A_PDB header: transferaseChain: A: PDB Molecule: purine nucleoside phosphorylase deod-type;PDBTitle: crystal structure of the hexameric purine nucleoside phosphorylase2 from bacillus subtilis in space group h32 at ph 7.5


Added to library: Wed Jan 9 23:08:33 2013
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence SVHIGAEKGQIADTVLLPGDPLRAKFIAETYLENVECYNEVRGMYGFTGTYKGKKISVQGTGMGVPSISI
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP)

S



TTSS
S
SS

GGG

TT


SS
 .........80.........90.........100.........110.........120.........130.........140
Sequence YVNELIQSYDVQNLIRVGSCGAIRKDVKVRDVILAMTSSTDSQMNRVAFGSVDFAPCADFELLKNAYDAA
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP)



STT

TT
S
STT







 .........150.........160.........170.........180.........190.........200.........210
Sequence KDKGVPVTVGSVFTADQFYNDDSQIEKLAKYGVLGVEMETTALYTLAAKHGRKALSILTVSDHVLTGEET
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) TT


S
SS
TT

TT

SSTT
TTT

B
 .........220.........230.
Sequence TAEERQTTFHDMIDVALHSVS
Predicted secondary structure

SS confidence




















Known secondary structure (DSSP)
TS


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D