Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c4ctiA_

Fold library idPDB HeaderMoleculeTitle
c4ctiA_PDB header: signaling proteinChain: A: PDB Molecule: osmolarity sensor protein envz, af1503;PDBTitle: escherichia coli envz histidine kinase catalytic part fused2 to archaeoglobus fulgidus af1503 hamp domain


Added to library: Sat Apr 12 09:01:32 2014
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence TITRPIIELSNTFDKIAEGNLEAEVPHQNRADEIGILAKSIERLRRSLKQLADDRTLLMAGVSHDLRTPL
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP)

TT

SS




S
SSTSS
 .........80.........90.........100.........110.........120.........130.........140
Sequence TRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEDLNAVLGEVIAEIETALYKMHPLSIK
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) GGGS
STTTTT








 .........150.........160.........170.........180.........190.........200.......
Sequence RAVANMVVNAARYGNGWIKVSSGTEPAWFQVEDDGPSGTGLGLAIVQRIVDNHNGMLELGLSIRAWL
Predicted secondary structure

























SS confidence


































































Known secondary structure (DSSP) S
SS












TT




Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D