Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c4ctiA_

Fold library idPDB HeaderMoleculeTitle
c4ctiA_PDB header: signaling proteinChain: A: PDB Molecule: osmolarity sensor protein envz, af1503;PDBTitle: escherichia coli envz histidine kinase catalytic part fused2 to archaeoglobus fulgidus af1503 hamp domain


Added to library: Sat Apr 12 09:01:32 2014
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence TITRPIIELSNTFDKIAEGNLEAEVPHQNRADEIGILAKSIERLRRSLKQLADDRTLLMAGVSHDLRTPL
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP)

TT

SS




S
SSTSS
 .........80.........90.........100.........110.........120.........130.........140
Sequence TRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEDLNAVLGEVIAEIETALYKMHPLSIK
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) GGGS
STTTTT








 .........150.........160.........170.........180.........190.........200.......
Sequence RAVANMVVNAARYGNGWIKVSSGTEPAWFQVEDDGPSGTGLGLAIVQRIVDNHNGMLELGLSIRAWL
Predicted secondary structure

























SS confidence


































































Known secondary structure (DSSP) S
SS












TT




Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D