Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c4cr4O_

Fold library idPDB HeaderMoleculeTitle
c4cr4O_PDB header: hydrolaseChain: O: PDB Molecule: 26s proteasome regulatory subunit rpn9;PDBTitle: deep classification of a large cryo-em dataset defines the2 conformational landscape of the 26s proteasome


Added to library: Sat Apr 5 08:18:18 2014
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MFNNHEIDTILSTLRMEADPSLHPLFEQFEKFYEEKLWFQLSESLTKFFDDAKSTPLRLRLYDNFVSKFY
Predicted secondary structure















SS confidence





































































Known secondary structure (DSSP)

TS
TT
SS

TT
SSS

S


TTGGGT


SS

STTTT
 .........80.........90.........100.........110.........120.........130.........140
Sequence DKINQLSVVKYLLASLKDSKDFDESLKYLDDLKAQFQELDSKKQRNNGSKDHGDGILLIDSEIARTYLLK
Predicted secondary structure












SS confidence





































































Known secondary structure (DSSP) T
STTTT
SS

SSSSSS
S



SSSS

 .........150.........160.........170.........180.........190.........200.........210
Sequence NDLVKARDLLDDLEKTLDKKDSIPLRITNSFYSTNSQYFKFKNDFNSFYYTSLLYLSTLEPSTSITLAER
Predicted secondary structure














SS confidence





































































Known secondary structure (DSSP) S



SSSS

TTS



 .........220.........230.........240.........250.........260.........270.........280
Sequence QQLAYDLSISALLGDKIYNFGELLHHPIMETIVNDSNYDWLFQLLNALTVGDFDKFDSLIKVQISKIPIL
Predicted secondary structure

















SS confidence





































































Known secondary structure (DSSP)


SS
TSS
TTTS
SSSSS

S

T
 .........290.........300.........310.........320.........330.........340.........350
Sequence AQHESFLRQKICLMTLIETVFVKNIRMLSFEDISKATHLPKDNVEHLVMRAISLGLLKGSIDQVNELVTI
Predicted secondary structure

















SS confidence





































































Known secondary structure (DSSP)
SS


T

TSSTTTT
 .........360.........370.........380.......
Sequence SWVQPRIISGDQITKMKDRLVEWNDQVEKLGKKMEAR
Predicted secondary structure







SS confidence




































Known secondary structure (DSSP) S






SS


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D