Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c4cr4O_

Fold library idPDB HeaderMoleculeTitle
c4cr4O_PDB header: hydrolaseChain: O: PDB Molecule: 26s proteasome regulatory subunit rpn9;PDBTitle: deep classification of a large cryo-em dataset defines the2 conformational landscape of the 26s proteasome


Added to library: Sat Apr 5 08:18:18 2014
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MFNNHEIDTILSTLRMEADPSLHPLFEQFEKFYEEKLWFQLSESLTKFFDDAKSTPLRLRLYDNFVSKFY
Predicted secondary structure















SS confidence





































































Known secondary structure (DSSP)

TS
TT
SS

TT
SSS

S


TTGGGT


SS

STTTT
 .........80.........90.........100.........110.........120.........130.........140
Sequence DKINQLSVVKYLLASLKDSKDFDESLKYLDDLKAQFQELDSKKQRNNGSKDHGDGILLIDSEIARTYLLK
Predicted secondary structure












SS confidence





































































Known secondary structure (DSSP) T
STTTT
SS

SSSSSS
S



SSSS

 .........150.........160.........170.........180.........190.........200.........210
Sequence NDLVKARDLLDDLEKTLDKKDSIPLRITNSFYSTNSQYFKFKNDFNSFYYTSLLYLSTLEPSTSITLAER
Predicted secondary structure














SS confidence





































































Known secondary structure (DSSP) S



SSSS

TTS



 .........220.........230.........240.........250.........260.........270.........280
Sequence QQLAYDLSISALLGDKIYNFGELLHHPIMETIVNDSNYDWLFQLLNALTVGDFDKFDSLIKVQISKIPIL
Predicted secondary structure

















SS confidence





































































Known secondary structure (DSSP)


SS
TSS
TTTS
SSSSS

S

T
 .........290.........300.........310.........320.........330.........340.........350
Sequence AQHESFLRQKICLMTLIETVFVKNIRMLSFEDISKATHLPKDNVEHLVMRAISLGLLKGSIDQVNELVTI
Predicted secondary structure

















SS confidence





































































Known secondary structure (DSSP)
SS


T

TSSTTTT
 .........360.........370.........380.......
Sequence SWVQPRIISGDQITKMKDRLVEWNDQVEKLGKKMEAR
Predicted secondary structure







SS confidence




































Known secondary structure (DSSP) S






SS


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D