Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c4cr3Q_

Fold library idPDB HeaderMoleculeTitle
c4cr3Q_PDB header: hydrolaseChain: Q: PDB Molecule: 26s proteasome regulatory subunit rpn6;PDBTitle: deep classification of a large cryo-em dataset defines the2 conformational landscape of the 26s proteasome


Added to library: Sat Apr 5 08:23:28 2014
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MSLPGSKLEEARRLVNEKQYNEAEQVYLSLLDKDSSQSSAAAGASVDDKRRNEQETSILELGQLYVTMGA
Predicted secondary structure










SS confidence





































































Known secondary structure (DSSP)

ST
S


SSS
SSSSS
SST
 .........80.........90.........100.........110.........120.........130.........140
Sequence KDKLREFIPHSTEYMMQFAKSKTVKVLKTLIEKFEQVPDSLDDQIFVCEKSIEFAKREKRVFLKHSLSIK
Predicted secondary structure










SS confidence





































































Known secondary structure (DSSP) TTGGGS
TS
S
TTT

SSTT
 .........150.........160.........170.........180.........190.........200.........210
Sequence LATLHYQKKQYKDSLALINDLLREFKKLDDKPSLVDVHLLESKVYHKLRNLAKSKASLTAARTAANSIYC
Predicted secondary structure













SS confidence





































































Known secondary structure (DSSP) T
TTTT
TT
TTS

 .........220.........230.........240.........250.........260.........270.........280
Sequence PTQTVAELDLMSGILHCEDKDYKTAFSYFFESFESYHNLTTHNSYEKACQVLKYMLLSKIMLNLIDDVKN
Predicted secondary structure










SS confidence





































































Known secondary structure (DSSP)
SS
GGGS
T
 .........290.........300.........310.........320.........330.........340.........350
Sequence ILNAKYTKETYQSRGIDAMKAVAEAYNNRSLLDFNTALKQYEKELMGDELTRSHFNALYDTLLESNLCKI
Predicted secondary structure






SS confidence





































































Known secondary structure (DSSP)
SSSSTT


T
TTTS
 .........360.........370.........380.........390.........400.........410.........420
Sequence IEPFECVEISHISKIIGLDTQQVEGKLSQMILDKIFYGVLDQGNGWLYVYETPNQDATYDSALELVGQLN
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP) TSS
STS
TT
SSTTTT

SS
TTTT
 .........430.
Sequence KVVDQLFEKAS
Predicted secondary structure

SS confidence










Known secondary structure (DSSP)


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D