Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c4cr3Q_

Fold library idPDB HeaderMoleculeTitle
c4cr3Q_PDB header: hydrolaseChain: Q: PDB Molecule: 26s proteasome regulatory subunit rpn6;PDBTitle: deep classification of a large cryo-em dataset defines the2 conformational landscape of the 26s proteasome


Added to library: Sat Apr 5 08:23:28 2014
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MSLPGSKLEEARRLVNEKQYNEAEQVYLSLLDKDSSQSSAAAGASVDDKRRNEQETSILELGQLYVTMGA
Predicted secondary structure










SS confidence





































































Known secondary structure (DSSP)

ST
S


SSS
SSSSS
SST
 .........80.........90.........100.........110.........120.........130.........140
Sequence KDKLREFIPHSTEYMMQFAKSKTVKVLKTLIEKFEQVPDSLDDQIFVCEKSIEFAKREKRVFLKHSLSIK
Predicted secondary structure










SS confidence





































































Known secondary structure (DSSP) TTGGGS
TS
S
TTT

SSTT
 .........150.........160.........170.........180.........190.........200.........210
Sequence LATLHYQKKQYKDSLALINDLLREFKKLDDKPSLVDVHLLESKVYHKLRNLAKSKASLTAARTAANSIYC
Predicted secondary structure













SS confidence





































































Known secondary structure (DSSP) T
TTTT
TT
TTS

 .........220.........230.........240.........250.........260.........270.........280
Sequence PTQTVAELDLMSGILHCEDKDYKTAFSYFFESFESYHNLTTHNSYEKACQVLKYMLLSKIMLNLIDDVKN
Predicted secondary structure










SS confidence





































































Known secondary structure (DSSP)
SS
GGGS
T
 .........290.........300.........310.........320.........330.........340.........350
Sequence ILNAKYTKETYQSRGIDAMKAVAEAYNNRSLLDFNTALKQYEKELMGDELTRSHFNALYDTLLESNLCKI
Predicted secondary structure






SS confidence





































































Known secondary structure (DSSP)
SSSSTT


T
TTTS
 .........360.........370.........380.........390.........400.........410.........420
Sequence IEPFECVEISHISKIIGLDTQQVEGKLSQMILDKIFYGVLDQGNGWLYVYETPNQDATYDSALELVGQLN
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP) TSS
STS
TT
SSTTTT

SS
TTTT
 .........430.
Sequence KVVDQLFEKAS
Predicted secondary structure

SS confidence










Known secondary structure (DSSP)


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D