Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c4cr2Z_

Fold library idPDB HeaderMoleculeTitle
c4cr2Z_PDB header: hydrolaseChain: Z: PDB Molecule: 26s proteasome regulatory subunit rpn1;PDBTitle: deep classification of a large cryo-em dataset defines the2 conformational landscape of the 26s proteasome


Added to library: Sat Apr 5 08:26:02 2014
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence LELLVERLKEDDSSLYEASLNALKESIKNSTSSMTAVPKPLKFLRPTYPDLCSIYDKWTDPNLKSSLADV
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP)


TTS

SSSS



SSSSSSGGG


SSS
 .........80.........90.........100.........110.........120.........130.........140
Sequence LSILAMTYSENGKHDSLRYRLLSDVSDFEGWGHEYIRHLALEIGEVYNDQVEKDAEDETSSDGSKSDGSA
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) T


SSST
SS




SSSSTT
S

S


SS

 .........150.........160.........170.........180.........190.........200.........210
Sequence ATSGFEFSKEDTLRLCLDIVPYFLKHNGEEDAVDLLLEIESIDKLPQFVDENTFQRVCQYMVACVPLLPP
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP)
TTSSSS

T
T
SS
SSS
SS
 .........220.........230.........240.........250.........260.........270.........280
Sequence PEDVAFLKTAYSIYLSQNELTDAIALAVRLGEEDMIRSVFDATSDPVMHKQLAYILAAQKTSFEYEGVQD
Predicted secondary structure











SS confidence





































































Known secondary structure (DSSP)



TT
T



TTSTTTTT
 .........290.........300.........310.........320.........330.........340.........350
Sequence IIGNGKLSEHFLYLAKELNLTGPKVPEDIYKSHLDNSKSVFSSAGLDSAQQNLASSFVNGFLNLGYCNDK
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) SSS
SS


TTS








SSTTTS

T
 .........360.........370.........380.........390.........400.........410.........420
Sequence LIVDNDNWVYKTKGDGMTSAVASIGSIYQWNLDGLQQLDKYLYVDEPEVKAGALLGIGISASGVHDGEVE
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP)
SS
TTTT
TSSS
TTTS
TT
SS
 .........430.........440.........450.........460.........470.........480.........490
Sequence PALLLLQDYVTNPDTKISSAAILGLGIAFAGSKNDEVLGLLLPIAASTDLPIETAAMASLALAHVFVGTC
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP)
SS
TTT
S


TS

TTTTS

TTTTTS
 .........500.........510.........520.........530.........540.........550.........560
Sequence NGDITTSIMDNFLERTAIELKTDWVRFLALALGILYMGQGEQVDDVLETISAIEHPMTSAIEVLVGSCAY
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP)


TTTT
TSS
GGGGS

 .........570.........580.........590.........600.........610.........620.........630
Sequence TGTGDVLLIQDLLHRLTLAYAVLGIALIALGEDIGKEMSLRHFGHLMHYGNEHIRRMVPLAMGIVSVSDP
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP) TTS



TT



TTSS
 .........640.........650.........660.........670.........680.........690.........700
Sequence QMKVFDTLTRFSHDADLEVSMNSIFAMGLCGAGTNNARLAQLLRQLASYYSREQDALFITRLAQGLLHLG
Predicted secondary structure















SS confidence





































































Known secondary structure (DSSP)
TS
S
TTTS
SSTTTSSS
TTT
 .........710.........720.........730.........740.........750.........760.........770
Sequence KGTMTMDVFNDAHVLNKVTLASILTTAVGLVSPSFMLKHHQLFYMLNAGIRPKFILALNDEGEPIKVNVR
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP) TTT

S

SSS


SS
STTSSSS

SGGGGGGGGG


BSSSSSB





 .........780.........790.........800.........810...
Sequence VGQPVLLNHGERAELETDEYISYTSHIEGVVILKKNPDYREEE
Predicted secondary structure


































SS confidence










































Known secondary structure (DSSP)



TT

SSB

SS


SS
BSS


SSB


GGG




Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D