Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c4cr2R_

Fold library idPDB HeaderMoleculeTitle
c4cr2R_PDB header: hydrolaseChain: R: PDB Molecule: 26s proteasome regulatory subunit rpn7;PDBTitle: deep classification of a large cryo-em dataset defines the2 conformational landscape of the 26s proteasome


Added to library: Sat Apr 5 08:18:07 2014
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence NYEVSEKAFLLTQSKVSIEQRKEAAEFVLAKIKEEEMAPYYKYLCEEYLVNNGQSDLEHDEKSDSLNEWI
Predicted secondary structure
















SS confidence





































































Known secondary structure (DSSP)
S

S
TTSS

TSSSSSB


SS


B
SS



 .........80.........90.........100.........110.........120.........130.........140
Sequence KFDQELYNELCKKNESKIKELNEKIQKLEEDDEGELEQAQAWINLGEYYAQIGDKDNAEKTLGKSLSKAI
Predicted secondary structure






SS confidence





































































Known secondary structure (DSSP) S

STT
TTTT
ST
S
 .........150.........160.........170.........180.........190.........200.........210
Sequence STGAKIDVMLTIARLGFFYNDQLYVKEKLEAVNSMIEKGGDWERRNRYKTYYGIHCLAVRNFKEAAKLLV
Predicted secondary structure









SS confidence





































































Known secondary structure (DSSP) STT
SSS




T

S
 .........220.........230.........240.........250.........260.........270.........280
Sequence DSLATFTSIELTSYESIATYASVTGLFTLERTDLKSKVIDSPELLSLISTTAALQSISSLTISLYASDYA
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP)




S

TTS

S
SSSSTT

TTSTTTT
SS
 .........290.........300.........310.........320.........330.........340.........350
Sequence SYFPYLLETYANVLIPCKYLNRHADFFVREMRRKVYAQLLESYKTLSLKSMASAFGVSVAFLDNDLGKFI
Predicted secondary structure







SS confidence





































































Known secondary structure (DSSP) STTTTSSSSGGGTT
SSSSS
G
 .........360.........370.........380.........390.........400
Sequence PNKQLNCVIDRVNGIVETNRPDNKNAQYHLLVKQGDGLLTKLQKYGAAVR
Predicted secondary structure













SS confidence

















































Known secondary structure (DSSP) GGTS

TTTT

S




Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D