Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c4cr2R_

Fold library idPDB HeaderMoleculeTitle
c4cr2R_PDB header: hydrolaseChain: R: PDB Molecule: 26s proteasome regulatory subunit rpn7;PDBTitle: deep classification of a large cryo-em dataset defines the2 conformational landscape of the 26s proteasome


Added to library: Sat Apr 5 08:18:07 2014
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence NYEVSEKAFLLTQSKVSIEQRKEAAEFVLAKIKEEEMAPYYKYLCEEYLVNNGQSDLEHDEKSDSLNEWI
Predicted secondary structure
















SS confidence





































































Known secondary structure (DSSP)
S

S
TTSS

TSSSSSB


SS


B
SS



 .........80.........90.........100.........110.........120.........130.........140
Sequence KFDQELYNELCKKNESKIKELNEKIQKLEEDDEGELEQAQAWINLGEYYAQIGDKDNAEKTLGKSLSKAI
Predicted secondary structure






SS confidence





































































Known secondary structure (DSSP) S

STT
TTTT
ST
S
 .........150.........160.........170.........180.........190.........200.........210
Sequence STGAKIDVMLTIARLGFFYNDQLYVKEKLEAVNSMIEKGGDWERRNRYKTYYGIHCLAVRNFKEAAKLLV
Predicted secondary structure









SS confidence





































































Known secondary structure (DSSP) STT
SSS




T

S
 .........220.........230.........240.........250.........260.........270.........280
Sequence DSLATFTSIELTSYESIATYASVTGLFTLERTDLKSKVIDSPELLSLISTTAALQSISSLTISLYASDYA
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP)




S

TTS

S
SSSSTT

TTSTTTT
SS
 .........290.........300.........310.........320.........330.........340.........350
Sequence SYFPYLLETYANVLIPCKYLNRHADFFVREMRRKVYAQLLESYKTLSLKSMASAFGVSVAFLDNDLGKFI
Predicted secondary structure







SS confidence





































































Known secondary structure (DSSP) STTTTSSSSGGGTT
SSSSS
G
 .........360.........370.........380.........390.........400
Sequence PNKQLNCVIDRVNGIVETNRPDNKNAQYHLLVKQGDGLLTKLQKYGAAVR
Predicted secondary structure













SS confidence

















































Known secondary structure (DSSP) GGTS

TTTT

S




Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D