Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c4cobA_

Fold library idPDB HeaderMoleculeTitle
c4cobA_PDB header: hydrolaseChain: A: PDB Molecule: kynurenine formamidase;PDBTitle: crystal structure kynurenine formamidase from pseudomonas aeruginosa


Added to library: Sat Apr 5 08:19:39 2014
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence RYWDISPALDPNTPTWPGDTPFQQEWAARLDEQCPVNVGRITLSPHTGAHVDGPLHYRADGLPIGQVPLD
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP)





STTS


TTS




SSS





TTSSS
GGGT
TT


GGGS
GG
 .........80.........90.........100.........110.........120.........130.........140
Sequence VYMGPCRVIHCIGANPLVTPEHLAGQLDDLPSRVLLRTFERVPANWPEGFCAIAPATIECLAERGVRLVG
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP) GG
TT

S
GGGGTTS
TT

S

SS

SS

TT


TT

 .........150.........160.........170.........180.........190.........200......
Sequence IDTPSLDPQHSKTLDAHHAVGRHGMAILEGVVLDDVPAGDYELLALPLKFTHLDASPVRAVLRALP
Predicted secondary structure



































SS confidence

































































Known secondary structure (DSSP) SSS
SS
TT
SS
TT




TT

S





TT
S






Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D