Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c4cn0A_

Fold library idPDB HeaderMoleculeTitle
c4cn0A_PDB header: cell cycleChain: A: PDB Molecule: protein ahnak2;PDBTitle: an intertwined homodimer of the pdz homology domain of ahnak2


Added to library: Sat Apr 5 08:17:07 2014
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence EATEVTLKTEVEAGASGYSVTGGGDQGIFVKQVLKDSSAAKLFNLREGDQLLSTTVFFENIKYEDALKIL
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP)

S








S


S
TTS

TTSTT


TT







SS

 .........80.......
Sequence QYSEPYKVQFKIRRQLP
Predicted secondary structure






SS confidence
















Known secondary structure (DSSP) TTS











Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D