Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c4chmB_

Fold library idPDB HeaderMoleculeTitle
c4chmB_PDB header: cell cycleChain: B: PDB Molecule: imc sub-compartment protein isp1;PDBTitle: structure of inner membrane complex (imc) sub-compartment2 protein 1 (isp1) from toxoplasma gondii


Added to library: Sat Apr 12 08:18:35 2014
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence SMASPQVTAADIEDLHRRLLAGMAVLVLLQDGTRLQCILHYNEADSSLSISCEDKVRVIPLSDIKALLHT
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP)









TTS
TTTTTTGGG
S
 .........80.........90.........100.........110.........120....
Sequence RDQLQRVETKANLVDDESCVALHLLESGNCIPLRFDGVKDKTCFVDLLKKLKAA
Predicted secondary structure


















SS confidence





















































Known secondary structure (DSSP) TS
SSS

TT
TTTTT


SS


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D