Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c4ccsA_

Fold library idPDB HeaderMoleculeTitle
c4ccsA_PDB header: unknown functionChain: A: PDB Molecule: cbix;PDBTitle: the structure of cbix, the terminal enzyme for biosynthesis2 of siroheme in denitrifying bacteria


Added to library: Sat Apr 12 08:23:34 2014
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence RNVLIVAHGQPGDPAPQQRAIEALAARVAPLVPQACVRGATLAMPGALDRADDETLIYPLFMATGWFTRS
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP)



SS
GGG
TTSTTSTTTTTT

TT

SS
ST
 .........80.........90.........100.........110.........120.........130.........140
Sequence ELPRRLALAGAPKARILPPFGSDPGLPALCLALIAQAAETQGWPLAGTRLLVAAHGSGRSRAPSEAARRI
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP) TT
TT



GGG
TTT

GGG



SS
S
 .........150.........160.........170.........180.........190.........200.........210
Sequence AAGLAPYAAAATCGFIEEAPFIADAARDLPERAICLPLFATQAEHVTDDLPAALSQAGFQGLVLPPVGLA
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP) GGGSSSSSSSBTTT

SS

S
T
T

S


GGGS
 .........220......
Sequence PQVPAMIAESIKAALS
Predicted secondary structure

SS confidence















Known secondary structure (DSSP) TT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D