Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c4c87A_

Fold library idPDB HeaderMoleculeTitle
c4c87A_PDB header: hydrolaseChain: A: PDB Molecule: esterase;PDBTitle: esterase lpest1 from lactobacillus plantarum wcfs1


Added to library: Sat Apr 5 08:42:24 2014
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence YFQGXPTINSIQTTVNGVVKIVKPFNNDIAGEQFDPHVLQTLTAFKQPAILENDLAALRSGSLTPAIADP
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP)

S






TT
SSSS

SSS

TT
GGGGS





STT






S
 .........80.........90.........100.........110.........120.........130.........140
Sequence VGDAVTVQSRNITALNRTVSVEWLTPQNVINHTVLVYFHGGAFYGGVPGNNTVLLKLVAAKSHCEILNVD
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP) SGGGTTSS

SS

STTT


GGGG

 .........150.........160.........170.........180.........190.........200.........210
Sequence YSLAPEAPAPAGILDGLAIFQYLEQRDAETXITVAGDSAGANVIXAATNLNQQLGSNRINQQLLLYPVTA
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP)


TTTS
TT
TT
TT


S


S
 .........220.........230.........240.........250.........260.........270.........280
Sequence PNADHAGPLWDLAAFPIIDSQRAILTNYHDLFRQLDSIXTDYYVPENFDSHSPLISPLHQENFTXTPPTT
Predicted secondary structure

















































SS confidence





































































Known secondary structure (DSSP) TT

TTSGGG
GGGS


GGGS
TTS
TTSTTT
GGG
S

SS


 .........290.........300.........310.........320.........330.........340.
Sequence IXVGEFDPFRPQAWAYAQRLAAADTATTFIQYQGLNHAFAPLVDQYWQSQDVAQVXAAALI
Predicted secondary structure























SS confidence




























































Known secondary structure (DSSP) TT
TTTT

TT

TT
TT
TTT
TT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D