Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c4c87A_

Fold library idPDB HeaderMoleculeTitle
c4c87A_PDB header: hydrolaseChain: A: PDB Molecule: esterase;PDBTitle: esterase lpest1 from lactobacillus plantarum wcfs1


Added to library: Sat Apr 5 08:42:24 2014
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence YFQGXPTINSIQTTVNGVVKIVKPFNNDIAGEQFDPHVLQTLTAFKQPAILENDLAALRSGSLTPAIADP
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP)

S






TT
SSSS

SSS

TT
GGGGS





STT






S
 .........80.........90.........100.........110.........120.........130.........140
Sequence VGDAVTVQSRNITALNRTVSVEWLTPQNVINHTVLVYFHGGAFYGGVPGNNTVLLKLVAAKSHCEILNVD
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP) SGGGTTSS

SS

STTT


GGGG

 .........150.........160.........170.........180.........190.........200.........210
Sequence YSLAPEAPAPAGILDGLAIFQYLEQRDAETXITVAGDSAGANVIXAATNLNQQLGSNRINQQLLLYPVTA
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP)


TTTS
TT
TT
TT


S


S
 .........220.........230.........240.........250.........260.........270.........280
Sequence PNADHAGPLWDLAAFPIIDSQRAILTNYHDLFRQLDSIXTDYYVPENFDSHSPLISPLHQENFTXTPPTT
Predicted secondary structure

















































SS confidence





































































Known secondary structure (DSSP) TT

TTSGGG
GGGS


GGGS
TTS
TTSTTT
GGG
S

SS


 .........290.........300.........310.........320.........330.........340.
Sequence IXVGEFDPFRPQAWAYAQRLAAADTATTFIQYQGLNHAFAPLVDQYWQSQDVAQVXAAALI
Predicted secondary structure























SS confidence




























































Known secondary structure (DSSP) TT
TTTT

TT

TT
TT
TTT
TT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D