Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c4c4vA_

Fold library idPDB HeaderMoleculeTitle
c4c4vA_PDB header: protein transportChain: A: PDB Molecule: outer membrane protein assembly factor bama;PDBTitle: structure of the outer membrane protein insertase bama with one2 potra domain.


Added to library: Sat Apr 26 08:24:53 2014
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence FYVRKIRFEGNDTSKDAVLRREMRQMEGAWLGSDLVDQGKERLNRLGFFETVDTDTQRVPGSPDQVDVVY
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP)
T
SSS
T



SSSB

T


TT
SS
 .........80.........90.........100.........110.........120.........130.........140
Sequence KVKERNTGSFNFGIGYGTESGVSFQAGVQQDNWLGTGYAVGINGTKNDYQTYAELSVTNPYFTVDGVSLG
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP)





TTT
S

SSTTSS


SS
S

TTTT

 .........150.........160.........170.........180.........190.........200.........210
Sequence GRLFYNDFQADDADSSDYTNKSYGTDVTLGFPINEENSLRAGLGYVHNSLSNMQPQVAMWRYLYSMGEHP
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP) TTTTTBSS


SSSS


BTT


 .........220.........230.........240.........250.........260.........270.........280
Sequence STSDQDNSFKTDDFTFNYGWTYNKLDRGYFPTDGSRVNLTGKVTIPGSDNEYYKVTLDTATYVPIDDDHK
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP)
SS
S



SSSSS

S
TTSSS


SSSS
 .........290.........300.........310.........320.........330.........340.........350
Sequence WVVLGRTRWGYGDGLGGKEMPFYENFYAGGSSTVRGFQSNTIGPKAIYFPHQASAKDLCKSDDAVGGNAM
Predicted secondary structure










































SS confidence





































































Known secondary structure (DSSP) S

SSS


GGG
B
B
STTS
T
TT
BS
SS





S


BS
 .........360.........370.........380.........390.........400.........410.........420
Sequence AVASLEFITPTPFISDKYANSVRTSFFWDMGTVWDTNWDSSSGYPDYSDPSNIRMSAGIALQWMSPLGPL
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP)

TT

SGGGGG
TT





S

TT




TT
 .........430.........440.....
Sequence VFSYAQPFKKYDGDKAEQFQFNIGK
Predicted secondary structure









SS confidence
























Known secondary structure (DSSP)

TT

S


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D