Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c4c2lA_

Fold library idPDB HeaderMoleculeTitle
c4c2lA_PDB header: hydrolaseChain: A: PDB Molecule: endo-xylogalacturonan hydrolase a;PDBTitle: crystal structure of endo-xylogalacturonan hydrolase from2 aspergillus tubingensis


Added to library: Sat Sep 28 08:28:26 2013
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence AVCTPTAGGDSSTDDVPAITEALSSCGNGGTIVFPEGSTYYLNSVLDLGSCSDCDIQVEGLLKFASDTDY
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP)






STTS

TBT

TT

S

TT
BS
S


 .........80.........90.........100.........110.........120.........130.........140
Sequence WSGRTAMISVSNVDGLKLRSLTGSGVIDGNGQDAWDLFASDSSYSRPTLLYITGGSNLEISGLRQKNPPN
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP) TT
SS

SSS



T
TT



S
S


SS
 .........150.........160.........170.........180.........190.........200.........210
Sequence VFNSVKGGATNVVFSNLKMDANSKSDNPPKNTDGFDIGESTYVTITEVTVVNDDDCVAFKPSSNYVTVDT
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP)
STT


SSSS

TT

S
S
SS
S
TT
 .........220.........230.........240.........250.........260.........270.........280
Sequence ISCTGSHGISVGSLGKSSDDSVKNIYVTGATMINSTKAAGIKTYPSGGDHGTSTVSNVTFNDFTVDNSDY
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP) S



SSS
S
S

SSTT


S
 .........290.........300.........310.........320.........330.........340.........350
Sequence AFQIQSCYGEDDDYCEENPGNAKLTDIVVSSFSGTTSDKYDPVVANLDCGADGTCGISISGFDVKAPSGK
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP) SSTTS
S




SSSTT

TTS

B
TTS
 .........360.........370..
Sequence SEVLCANTPSDLGVTCTSGASG
Predicted secondary structure
















SS confidence





















Known secondary structure (DSSP)
S

TT
SS






Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D