Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c4c2lA_

Fold library idPDB HeaderMoleculeTitle
c4c2lA_PDB header: hydrolaseChain: A: PDB Molecule: endo-xylogalacturonan hydrolase a;PDBTitle: crystal structure of endo-xylogalacturonan hydrolase from2 aspergillus tubingensis


Added to library: Sat Sep 28 08:28:26 2013
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence AVCTPTAGGDSSTDDVPAITEALSSCGNGGTIVFPEGSTYYLNSVLDLGSCSDCDIQVEGLLKFASDTDY
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP)






STTS

TBT

TT

S

TT
BS
S


 .........80.........90.........100.........110.........120.........130.........140
Sequence WSGRTAMISVSNVDGLKLRSLTGSGVIDGNGQDAWDLFASDSSYSRPTLLYITGGSNLEISGLRQKNPPN
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP) TT
SS

SSS



T
TT



S
S


SS
 .........150.........160.........170.........180.........190.........200.........210
Sequence VFNSVKGGATNVVFSNLKMDANSKSDNPPKNTDGFDIGESTYVTITEVTVVNDDDCVAFKPSSNYVTVDT
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP)
STT


SSSS

TT

S
S
SS
S
TT
 .........220.........230.........240.........250.........260.........270.........280
Sequence ISCTGSHGISVGSLGKSSDDSVKNIYVTGATMINSTKAAGIKTYPSGGDHGTSTVSNVTFNDFTVDNSDY
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP) S



SSS
S
S

SSTT


S
 .........290.........300.........310.........320.........330.........340.........350
Sequence AFQIQSCYGEDDDYCEENPGNAKLTDIVVSSFSGTTSDKYDPVVANLDCGADGTCGISISGFDVKAPSGK
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP) SSTTS
S




SSSTT

TTS

B
TTS
 .........360.........370..
Sequence SEVLCANTPSDLGVTCTSGASG
Predicted secondary structure
















SS confidence





















Known secondary structure (DSSP)
S

TT
SS






Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D