Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c4c00A_

Fold library idPDB HeaderMoleculeTitle
c4c00A_PDB header: transport proteinChain: A: PDB Molecule: translocation and assembly module tama;PDBTitle: crystal structure of tama from e. coli


Added to library: Sat Sep 28 08:29:33 2013
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence RLQVEGLSGQLEKNVRAQLSTIESDEVTPDRRFRARVDDAIREGLKALGYYQPTIEFDLVLIAKVTPGVP
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP)
S

STTTS

SSS

SSSSTTT




 .........80.........90.........100.........110.........120.........130.........140
Sequence VLIGGTDVVLRGGARTDKDYLKLLDTRPAIGTVLNQGDYENFKKSLTSIALRKGYFDSEFTKAQLGIALG
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP)
GGGG
GGGS

TTSB

T
TT
TT
 .........150.........160.........170.........180.........190.........200.........210
Sequence LHKAFWDIDYNSGERYRFGHVTFEGSQIRDEYLQNLVPFKEGDEYESKDLAELNRRLSATGWFNSVVVAP
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP) TT


S
SS
TT

S
TT
B

TS
 .........220.........230.........240.........250.........260.........270.........280
Sequence QFDKARETKVLPLTGVVSPRTENTIETGVGYSTDVGPRVKATWKKPWMNSYGHSLTTSTSISAPEQTLDF
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP)



S
TTTS
SSTT

SS
 .........290.........300.........310.........320.........330.........340.........350
Sequence SYKMPLLKNPLEQYYLVQGGFKRTDLNDTESDSTTLVASRYWDLSSGWQRAINLRWSLDHFTQGEITNTT
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP)
TTSTTTTT
TTSTT
 .........360.........370.........380.........390.........400.........410.........420
Sequence MLFYPGVMISRTRSRGGLMPTWGDSQRYSIDYSNTAWGSDVDFSVFQAQNVWIRTLYDRHRFVTRGTLGW
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP) SSSS
S
GGGT
SS
TTT
 .........430.........440.........450.........460.........470.........480.........490
Sequence IETGDFDKVPPDLRFFAGGDRSIRGYKYKSIAPKYANGDLKGASKLITGSLEYQYNVTGKWWGAVFVDSG
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP) S
GGGS
GGGSB
B
BTTTBTTS
TT
BS
B
TTS
B

BSTT
 .........500.........510.........520.........530.........540....
Sequence EAVSDIRRSDFKTGTGVGVRWESPVGPIKLDFAVPVADKDEHGLQFYIGLGPEL
Predicted secondary structure



















SS confidence





















































Known secondary structure (DSSP) S
TTS


TTSS
TT

S






Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D