Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c4c00A_

Fold library idPDB HeaderMoleculeTitle
c4c00A_PDB header: transport proteinChain: A: PDB Molecule: translocation and assembly module tama;PDBTitle: crystal structure of tama from e. coli


Added to library: Sat Sep 28 08:29:33 2013
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence RLQVEGLSGQLEKNVRAQLSTIESDEVTPDRRFRARVDDAIREGLKALGYYQPTIEFDLVLIAKVTPGVP
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP)
S

STTTS

SSS

SSSSTTT




 .........80.........90.........100.........110.........120.........130.........140
Sequence VLIGGTDVVLRGGARTDKDYLKLLDTRPAIGTVLNQGDYENFKKSLTSIALRKGYFDSEFTKAQLGIALG
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP)
GGGG
GGGS

TTSB

T
TT
TT
 .........150.........160.........170.........180.........190.........200.........210
Sequence LHKAFWDIDYNSGERYRFGHVTFEGSQIRDEYLQNLVPFKEGDEYESKDLAELNRRLSATGWFNSVVVAP
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP) TT


S
SS
TT

S
TT
B

TS
 .........220.........230.........240.........250.........260.........270.........280
Sequence QFDKARETKVLPLTGVVSPRTENTIETGVGYSTDVGPRVKATWKKPWMNSYGHSLTTSTSISAPEQTLDF
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP)



S
TTTS
SSTT

SS
 .........290.........300.........310.........320.........330.........340.........350
Sequence SYKMPLLKNPLEQYYLVQGGFKRTDLNDTESDSTTLVASRYWDLSSGWQRAINLRWSLDHFTQGEITNTT
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP)
TTSTTTTT
TTSTT
 .........360.........370.........380.........390.........400.........410.........420
Sequence MLFYPGVMISRTRSRGGLMPTWGDSQRYSIDYSNTAWGSDVDFSVFQAQNVWIRTLYDRHRFVTRGTLGW
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP) SSSS
S
GGGT
SS
TTT
 .........430.........440.........450.........460.........470.........480.........490
Sequence IETGDFDKVPPDLRFFAGGDRSIRGYKYKSIAPKYANGDLKGASKLITGSLEYQYNVTGKWWGAVFVDSG
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP) S
GGGS
GGGSB
B
BTTTBTTS
TT
BS
B
TTS
B

BSTT
 .........500.........510.........520.........530.........540....
Sequence EAVSDIRRSDFKTGTGVGVRWESPVGPIKLDFAVPVADKDEHGLQFYIGLGPEL
Predicted secondary structure



















SS confidence





















































Known secondary structure (DSSP) S
TTS


TTSS
TT

S






Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D