Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c4bzyC_

Fold library idPDB HeaderMoleculeTitle
c4bzyC_PDB header: transferaseChain: C: PDB Molecule: 1,4-alpha-glucan-branching enzyme;PDBTitle: crystal structure of human glycogen branching enzyme (gbe1)


Added to library: Sat Sep 28 08:38:10 2013
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence QRRYKQFSQILKNIGENEGGIDKFSRGYESFGVHRCADGGLYCKEWAPGAEGVFLTGDFNGWNPFSYPYK
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP)
SS
TTGGGTS
TTS

TT
SGGGTT
SSSSB
 .........80.........90.........100.........110.........120.........130.........140
Sequence KLDYGKWELYIPPKQNKSVLVPHGSKLKVVITSKSGEILYRISPWAKYVVREGDNVNYDWIHWDPEHSYE
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP)
STT


TT


SS
TT

TT



TT
S


TT
SS




SS


 .........150.........160.........170.........180.........190.........200.........210
Sequence FKHSRPKKPRSLRIYESHVGISSHEGKVASYKHFTCNVLPRIKGLGYNCIQLMAIMEHAYYASFGYQITS
Predicted secondary structure










































SS confidence





































































Known secondary structure (DSSP)

S





SSSTTSSSSSS


TT

S

S
GGGTT
S
S
 .........220.........230.........240.........250.........260.........270.........280
Sequence FFAASSRYGSPEELQELVDTAHSMGIIVLLDVVHSHASKNSADGLNMFDGTDSCYFHSGPRGTHDLWDSR
Predicted secondary structure











































SS confidence





































































Known secondary structure (DSSP)
GGG

TT

S
B


SSSSSTTTTSSS
SSB
SSGGGTTTT
 .........290.........300.........310.........320.........330.........340.........350
Sequence LFAYSSWEVLRFLLSNIRWWLEEYRFDGFRFDGVTSMLYHLQVDEDALTYLMLANHLVHTLCPDSITIAE
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP)
B
TTSTS


T






TT

 .........360.........370.........380.........390.........400.........410.........420
Sequence DVSGMPALCSPISQGGGGFDYRLAMAIPDKWIQLLKEFKDEDWNMGDIVYTLTNRRYLEKCIAYAESHDQ
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP)
SS

TTTTS
GGGT



S
T

GGG




TT

SS
GGG
 .........430.........440.........450.........460.........470.........480.........490
Sequence ALVGDKSLAFWLMDAEMYTNMSVLTPFTPVIDRGIQLHKMIRLITHGLGGEGYLNFMGNEFGHPEWLDFP
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP) GBTTS

GGGGGTS
BTTS


S
STTGGGT

S
B


 .........500.........510.........520.........530.........540.........550.........560
Sequence RKGNNESYHYARRQFHLTDDDLLRYKFLNNFDRDMNRLEERYGWLAAPQAYVSEKHEGNKIIAFERAGLL
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP)
GGGTS

TTSS

GGGGT
TTBS
TTSS


TTTTTT
 .........570.........580.........590.........600.........610.........620.........630
Sequence FIFNFHPSKSYTDYRVGTALPGKFKIVLDSDAAEYGGHQRLDHSTDFFSEAFEHNGRPYSLLVYIPSRVA
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP)

SS

SS
TTSGGGT



S
TT

TT
TT
 .......
Sequence LILQNVD
Predicted secondary structure

SS confidence






Known secondary structure (DSSP)


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D