Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c4bz0A_

Fold library idPDB HeaderMoleculeTitle
c4bz0A_PDB header: motor proteinChain: A: PDB Molecule: putative type iv pilus biosynthesis protein;PDBTitle: structural characterization using sulfur-sad of the cytoplasmic2 domain of burkholderia pseudomallei pilo2bp, an actin-like3 protein component of a type ivb r64-derivative pilus machinery.


Added to library: Sat Apr 26 08:16:01 2014
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence QVIQIGRQRFVGGLFWQSLSRRNELRAEAVELAKKLKFDLMVLRIDRGVAAAGYANTRDGFAPGHLSLGA
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP)

TT




SSS
T
STT
GGGT

TT
 .........80.........90.........100.........110.........120.........130.........140
Sequence MVSRAIALEGAFYNGRRQPAPNWLGAFALPDGRWAYFAVRDHAFMPNGDWVGSREEALERLHTDYAWGGW
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP)
TT

SS
TTS
TT
TT


 .........150.........160.........170......
Sequence NVVIGEPELERQGFQNFQPKRLDDLLTERWWALRPV
Predicted secondary structure














SS confidence



































Known secondary structure (DSSP) S
GGGGGG

SS

GGGT


GGGB


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D