Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c4bz0A_

Fold library idPDB HeaderMoleculeTitle
c4bz0A_PDB header: motor proteinChain: A: PDB Molecule: putative type iv pilus biosynthesis protein;PDBTitle: structural characterization using sulfur-sad of the cytoplasmic2 domain of burkholderia pseudomallei pilo2bp, an actin-like3 protein component of a type ivb r64-derivative pilus machinery.


Added to library: Sat Apr 26 08:16:01 2014
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence QVIQIGRQRFVGGLFWQSLSRRNELRAEAVELAKKLKFDLMVLRIDRGVAAAGYANTRDGFAPGHLSLGA
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP)

TT




SSS
T
STT
GGGT

TT
 .........80.........90.........100.........110.........120.........130.........140
Sequence MVSRAIALEGAFYNGRRQPAPNWLGAFALPDGRWAYFAVRDHAFMPNGDWVGSREEALERLHTDYAWGGW
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP)
TT

SS
TTS
TT
TT


 .........150.........160.........170......
Sequence NVVIGEPELERQGFQNFQPKRLDDLLTERWWALRPV
Predicted secondary structure














SS confidence



































Known secondary structure (DSSP) S
GGGGGG

SS

GGGT


GGGB


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D