Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c4bxrB_

Fold library idPDB HeaderMoleculeTitle
c4bxrB_PDB header: cell cycleChain: B: PDB Molecule: cpap;PDBTitle: structure of the wild-type tcp10 domain of danio rerio cpap2 in complex with a peptide of danio rerio stil


Added to library: Sat Sep 28 08:21:37 2013
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence SKIEKMLPDGGRLVVFPNGTRKELSADGQTVKVMFFNGDVKHTMPDQRVIYYYAEAQTTHITYPDGMEVL
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP)


TTS

TTS

TTS


TTS

TT

TTTT
TTS
 .........80.........90.........100.........110.........120.........130.........140
Sequence QFPNNQTEKHFPDGRKEITFPDQTVKTLHPDGREESVLTDGTIIQLNPDGSKVIQFNTGQREIHTADFKR
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP)
TTS

TTS

TT


TTS

TTS

TTS

TTS

SS
 .........150.........160.........170.........180.
Sequence REYPDGTVKTVYSDGRQETQYPTGRVRLKDPQGKVIMDTKA
Predicted secondary structure




















SS confidence








































Known secondary structure (DSSP)
TTS
TTS

TTS
TTS


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D