Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c4bsrB_

Fold library idPDB HeaderMoleculeTitle
c4bsrB_PDB header: signaling proteinChain: B: PDB Molecule: leucine-rich repeat-containing g-protein coupled receptorPDBTitle: structure of the ectodomain of lgr5 in complex with r-spondin-12 (fu1fu2) in p22121 crystal form


Added to library: Sat Jun 22 10:25:57 2013
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence LRGCPTHCHCEPDGRMLLRVDCSDLGLSELPSNLSVFTSYLDLSMNNISQLLPNPLPSLRFLEELRLAGN
Predicted secondary structure



















































SS confidence





































































Known secondary structure (DSSP)

SS
TT
SSTT


SS

SS

SS

TT

SS

SSS
SS




TT


TTS
 .........80.........90.........100.........110.........120.........130.........140
Sequence ALTYIPKGAFTGLYSLKVLMLQNNQLRHVPTEALQNLRSLQSLRLDANHISYVPPSCFSGLHSLRHLWLD
Predicted secondary structure






























































SS confidence





































































Known secondary structure (DSSP)

S


TTTTSS
TT



SS

SB

TTTTTT
TT



SS


B

TTSSTT

S



 .........150.........160.........170.........180.........190.........200.........210
Sequence DNALTEIPVQAFRSLSALQAMTLALNKIHHIPDYAFGNLSSLVVLHLHNNRIHSLGKKCFDGLHSLETLD
Predicted secondary structure





































































SS confidence





































































Known secondary structure (DSSP) SS


S

TT
TT



SS



TTTTTT
TT



SS



TTTT
S
SS

 .........220.........230.........240.........250.........260.........270.........280
Sequence LNYNNLDEFPTAIRTLSNLKELGFHSNNIRSIPEKAFVGNPSLITIHFYDNPIQFVGRSAFQHLPELRTL
Predicted secondary structure





































































SS confidence





































































Known secondary structure (DSSP)

S


SS

GGGGG
TT



SS



TTSSTT
TT


TTS



GGGG
S
TT

 .........290.........300.........310.........320.........330.........340.........350
Sequence TLNGASQITEFPDLTGTANLESLTLTGAQISSLPQTVCNQLPNLQVLDLSYNLLEDLPSFSVCQKLQKID
Predicted secondary structure





































































SS confidence





































































Known secondary structure (DSSP)

TT

S



TT



SSS





TTSGGG
SS



SS


S



SS
TT

 .........360.........370.........380.........390.........400.........410.........420
Sequence LRHNEIYEIKVDTFQQLLSLRSLNLAWNKIAIIHPNAFSTLPSLIKLDLSSNLLSSFPITGLHGLTHLKL
Predicted secondary structure
























































SS confidence





































































Known secondary structure (DSSP)

SS



SGGGTT
TT



SS



TTTTTT
TT



SS

SS


SS

S
S
 .........430.........440.........450.........460.........470.........480
Sequence TGNHALQSLISSENFPELKVIEMPYAYQCCAFGVCERDLEDFLLDFEEDLKALHSVQCSP
Predicted secondary structure



















































SS confidence



























































Known secondary structure (DSSP) TT
TT

S


STT
TT


SSGGGT


TTTSS


Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D