Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c4bsjA_

Fold library idPDB HeaderMoleculeTitle
c4bsjA_PDB header: transferaseChain: A: PDB Molecule: vascular endothelial growth factor receptor 3;PDBTitle: crystal structure of vegfr-3 extracellular domains d4-5


Added to library: Sat Aug 3 08:57:42 2013
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence DHNPFISVEWLKGPILEATAGDELVKLPVKLAAYPPPEFQWYKDGKALSGRHSPHALVLKEVTEASTGTY
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP)



SS
STT
S

TT

S


SS

GGG
 .........80.........90.........100.........110.........120.........130.........140
Sequence TLALWNSAAGLRRNISLELVVNVPPQIHEKEASSPSIYSRHSRQALTCTAYGVPLPLSIQWHWRPWTPCK
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) TTTTGGGGS


S
TT

S




SS

S
 .........150.........160.........170.........180.........190.........200.........210
Sequence MFPQCRDWRAVTTQDAVNPIESLDTWTEFVEGKNKTVSKLVIQNANVSAMYKCVVSNKVGQDERLIYFYV
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP)




S



STT
SS
TTS


S
TT
 ...
Sequence TTH
Predicted secondary structure
SS confidence


Known secondary structure (DSSP)


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D