Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c4bpxC_

Fold library idPDB HeaderMoleculeTitle
c4bpxC_PDB header: transferaseChain: C: PDB Molecule: dna primase small subunit;PDBTitle: crystal structure of human primase in complex with the2 primase-binding motif of dna polymerase alpha


Added to library: Sat Sep 28 08:24:42 2013
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence FDPTELPELLKLYYRRLFPYSQYYRWLNYGGVIKNYFQHREFSFTLKDDIYIRYQSFNNQSDLEKEMQAA
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP)

TTSTS
GGG
STTTTTT
GGG


SS
 .........80.........90.........100.........110.........120.........130.........140
Sequence NPYKIDIGAVYSHRPNQHNTVKLGAFQAQEKELVFDIDMTDYDDVRRCCSSADICPKCWTLMTMAIRIID
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP)

SSS
GGGTTTS
TTT



GGGGTTS
SS

TT


TTTT
 .........150.........160.........170.........180.........190.........200.........210
Sequence RALKEDFGFKHRLWVYSGRRGVHCWVCDESVRKLSSAVRSGIVEYLSLVKGGQDVKKKVHLSEKIHPFIR
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP) TS




SSS

T







SS
S





SS

 .........220.........230.........240.........250.........260.........270.........280
Sequence KSINIIKKYFEEYALVNQDILENKESWDKILALVPETIHDELQQSFQKSHNSLQRWEHLKKVASRYQNNP
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP) TTTT
TTSSTTS
GGG
SS

 .........290.........300.........310.........320.........330.........340.........350
Sequence WLEWEIMLQYCFPRLDINVSKGINHLLKSPFSVHPKTGRISVPIDLQKVDQFDPFTVPTISFICRELDAT
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP)
S



T
TT


TT
B
TTT
BB

B

GGG
TT

TTSS
BT

 .........360.........370..
Sequence SLAPYVKVFEHFLENLDKSRKG
Predicted secondary structure

SS confidence





















Known secondary structure (DSSP) TT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D