Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c4bpxB_

Fold library idPDB HeaderMoleculeTitle
c4bpxB_PDB header: transferaseChain: B: PDB Molecule: dna polymerase alpha catalytic subunit, dna primase largePDBTitle: crystal structure of human primase in complex with the2 primase-binding motif of dna polymerase alpha


Added to library: Sat Sep 28 08:22:34 2013
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence ISLIEFENLAIDRVKLLKSVENLSKLESELRKLRRDHISHFILRLAYCQSEELRRWFIQQEMDLLRFRFS
Predicted secondary structure










SS confidence





































































Known secondary structure (DSSP)





TTSS
 .........80.........90.........100.........110.........120.........130.........140
Sequence ILPKDKIQDFLKDSQLQFEAISDEEKTLREQEIVASSPSLLGFESIYKIPFADALDLFRGRKVYLEDGFA
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP) T

TT



B

STTT
S


TTS

GGGGTTT
STT
 .........150.........160.........170.........180.
Sequence YVPLKDIVAIILNEFRAKLSKALALTARSLDERLQPLLNHL
Predicted secondary structure




SS confidence








































Known secondary structure (DSSP)
TT

GGG


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D