Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c4bk8A_

Fold library idPDB HeaderMoleculeTitle
c4bk8A_PDB header: oxidoreductaseChain: A: PDB Molecule: desulfoferrodoxin, ferrous iron-binding region;PDBTitle: superoxide reductase (neelaredoxin) from ignicoccus2 hospitalis


Added to library: Sat Apr 5 08:18:47 2014
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence KSFGELIYTPDRAEGEAISKAETHTPKIEAPEKVKADQPFQVRVSVGPHPNEAAHSIRWIELYFYEEGRP
Predicted secondary structure












































SS confidence





































































Known secondary structure (DSSP)

SB
TT
GGGGT


S


S
TT



S


BTTB
TT
S
 .........80.........90.........100.........110.........120...
Sequence FNPVMLGRVAFEPGYAEPDVTFTLKLKKSGVLYAISYCNLHGLWEARKEIKVE
Predicted secondary structure



















SS confidence




















































Known secondary structure (DSSP) S



TTTS
S

SS
TTT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D