Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c4bjiA_

Fold library idPDB HeaderMoleculeTitle
c4bjiA_PDB header: dna binding proteinChain: A: PDB Molecule: transcription factor tau subunit sfc1;PDBTitle: sfc1-dbd


Added to library: Sat Aug 3 08:26:21 2013
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence RVWIITTNXGVESVPTCRHSKLGEPSKTIQEVIEALKPLFEKRPVWTRRALLNHLDPSYTHYLKFALPYL
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP)





TT
SS


S

TT





STTS
GGGTTTGGGT
 .........80.........90.........100.........110.........120.........130.........140
Sequence SYLWTSGPFRDTYTRFGYDPRKDSNAAAYQALFFKLKGTKTHVFDGKTLFPTNRVYQVCDIVDPTIAPLL
Predicted secondary structure







































SS confidence





































































Known secondary structure (DSSP)
SSTTTTTT

TTS
GGGGGG





B



B
S

SSB


GGGB

TTT
 .........150.........160.........170.........180.........190.....
Sequence KDTQLRSECHRDTGWYRSGRYYKVRDLXREKLFALIEGEXPSEVAVNXILNAEEV
Predicted secondary structure























SS confidence






















































Known secondary structure (DSSP) SS


SS
BTTTBTS
TTT



S



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D