Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c4bjiA_

Fold library idPDB HeaderMoleculeTitle
c4bjiA_PDB header: dna binding proteinChain: A: PDB Molecule: transcription factor tau subunit sfc1;PDBTitle: sfc1-dbd


Added to library: Sat Aug 3 08:26:21 2013
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence RVWIITTNXGVESVPTCRHSKLGEPSKTIQEVIEALKPLFEKRPVWTRRALLNHLDPSYTHYLKFALPYL
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP)





TT
SS


S

TT





STTS
GGGTTTGGGT
 .........80.........90.........100.........110.........120.........130.........140
Sequence SYLWTSGPFRDTYTRFGYDPRKDSNAAAYQALFFKLKGTKTHVFDGKTLFPTNRVYQVCDIVDPTIAPLL
Predicted secondary structure







































SS confidence





































































Known secondary structure (DSSP)
SSTTTTTT

TTS
GGGGGG





B



B
S

SSB


GGGB

TTT
 .........150.........160.........170.........180.........190.....
Sequence KDTQLRSECHRDTGWYRSGRYYKVRDLXREKLFALIEGEXPSEVAVNXILNAEEV
Predicted secondary structure























SS confidence






















































Known secondary structure (DSSP) SS


SS
BTTTBTS
TTT



S



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D