Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c4bg0A_

Fold library idPDB HeaderMoleculeTitle
c4bg0A_PDB header: cell adhesionChain: A: PDB Molecule: complement regulator-acquiring surface protein 2 (crasp-2PDBTitle: crystal structure of complement factors h and fhl-1 binding2 protein bbh06 or crasp-2 from borrelia burgdorferi


Added to library: Sat Apr 12 08:18:00 2014
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence GRLNQRNINELKIFVEKAKYYSIKLDAIYNECTGAYNDIMTYSDQSKVNQAISIFKKDNKIVNKFKELEK
Predicted secondary structure












SS confidence





































































Known secondary structure (DSSP)
TTT


GGG
 .........80.........90.........100.........110.........120.........130.........140
Sequence IIEEYKPMFLSKLIDDFAIELDQAVDNARHVADSYKKLRKSVVLAYIESFDVISSKFVDSKFVEASKKFV
Predicted secondary structure
SS confidence





































































Known secondary structure (DSSP) TTTT

TT

TT
S
 .........150.........160.........170.........180.........190.........200.....
Sequence NKAKEFVEENDLIALECIVKTIGDMVNDREINSRSRYNNFYKKEADFLGAAVELEGAYKAIKQTL
Predicted secondary structure
















SS confidence
































































Known secondary structure (DSSP)
TT




S
SSTT
STTTT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D