Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c4bg0A_

Fold library idPDB HeaderMoleculeTitle
c4bg0A_PDB header: cell adhesionChain: A: PDB Molecule: complement regulator-acquiring surface protein 2 (crasp-2PDBTitle: crystal structure of complement factors h and fhl-1 binding2 protein bbh06 or crasp-2 from borrelia burgdorferi


Added to library: Sat Apr 12 08:18:00 2014
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence GRLNQRNINELKIFVEKAKYYSIKLDAIYNECTGAYNDIMTYSDQSKVNQAISIFKKDNKIVNKFKELEK
Predicted secondary structure












SS confidence





































































Known secondary structure (DSSP)
TTT


GGG
 .........80.........90.........100.........110.........120.........130.........140
Sequence IIEEYKPMFLSKLIDDFAIELDQAVDNARHVADSYKKLRKSVVLAYIESFDVISSKFVDSKFVEASKKFV
Predicted secondary structure
SS confidence





































































Known secondary structure (DSSP) TTTT

TT

TT
S
 .........150.........160.........170.........180.........190.........200.....
Sequence NKAKEFVEENDLIALECIVKTIGDMVNDREINSRSRYNNFYKKEADFLGAAVELEGAYKAIKQTL
Predicted secondary structure
















SS confidence
































































Known secondary structure (DSSP)
TT




S
SSTT
STTTT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D