Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c4b93B_

Fold library idPDB HeaderMoleculeTitle
c4b93B_PDB header: exocytosisChain: B: PDB Molecule: ankyrin repeat domain-containing protein 27;PDBTitle: complex of vamp7 cytoplasmic domain with 2nd ankyrin repeat2 domain of varp


Added to library: Sat Nov 3 16:00:15 2012
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence KDYREVEKLLRAVADGDLEMVRYLLEWTSGLGVNVTSQDGSSPLHVAALHGRADLIPLLLKHGANAGARN
Predicted secondary structure



















































SS confidence





































































Known secondary structure (DSSP)


TT
T





TT


TTS

TT
TTTT

TT


 .........80.........90.........100.........110.........120.........130.........140
Sequence ADQAVPLHLACQQGHFQVVKCLLDSNAKPNKKDLSGNTPLIYACSGGHHELVALLLQHGASINASNNKGN
Predicted secondary structure





































































SS confidence





































































Known secondary structure (DSSP) TT


T
TT

S



TT


TT
GGGTT

TT
B
TTS
 .........150.........160.........170.........180.........190.
Sequence TALHEAVIEKHVFVVELLLLHGASVQVLNKRQRTAVDCAEQNSKIMELLQV
Predicted secondary structure



























SS confidence


















































Known secondary structure (DSSP) BTT
TT

S



TTS

SGGGS
TT
TT


Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D