Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c4b6aR_

Fold library idPDB HeaderMoleculeTitle
c4b6aR_PDB header: ribosomeChain: R: PDB Molecule: 60s ribosomal protein l19-b;PDBTitle: cryo-em structure of the 60s ribosomal subunit in complex2 with arx1 and rei1


Added to library: Wed Jan 9 15:08:37 2013
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence ANLRTQKRLAASVVGVGKRKVWLDPNETSEIAQANSRNAIRKLVKNGTIVKKAVTVHSKSRTRAHAQSKR
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP)

TTS
GGG
TT
T

STS







 .........80.........90.........100.........110.........120.........130.........140
Sequence EGRHSGYGKRKGTREARLPSQVVWIRRLRVLRRLLAKYRDAGKIDKHLYHVLYKESKGNAFKHKRALVEH
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP) TT
S
SGGG

S
S
TTSS
TTT

SS
 .........150.........160.........170.........180........
Sequence IIQAKADAQREKALNEEAEARRLKNRAARDRRAQRVAEKRDALLKEDA
Predicted secondary structure

SS confidence















































Known secondary structure (DSSP) TTTTTT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D