Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c4ay9Z_

Fold library idPDB HeaderMoleculeTitle
c4ay9Z_PDB header: hormone/receptorChain: Z: PDB Molecule: follicle-stimulating hormone receptor;PDBTitle: structure of follicle-stimulating hormone in complex with2 the entire ectodomain of its receptor


Added to library: Sat Aug 11 14:01:01 2012
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence CHHRICHCSNRVFLCQESKVTEIPSDLPRNAIELRFVLTKLRVIQKGAFSGFGDLEKIEISQNDVLEVIE
Predicted secondary structure

















































SS confidence





































































Known secondary structure (DSSP)


SSSTTSSS

S

TT

TT
SS


S
TTTTTT
TT



TT


 .........80.........90.........100.........110.........120.........130.........140
Sequence ADVFSNLPKLHEIRIEKANNLLYINPEAFQNLPNLQYLLISNTGIKHLPDVHKIHSLQKVLLDIQDNINI
Predicted secondary structure





























































SS confidence





































































Known secondary structure (DSSP) TTSB
S
TT

TT


TTSB


TT



SS



TT

BSS
S
TT
 .........150.........160.........170.........180.........190.........200.........210
Sequence HTIERNSFVGLSFESVILWLNKNGIQEIHNSAFNGTQLDELNLSDNNNLEELPNDVFHGASGPVILDISR
Predicted secondary structure
























































SS confidence





































































Known secondary structure (DSSP)

TTSSTTSBSS


SS



TTSSTT
TT
TT




TTTTTT

S
TT
 .........220.........230.........240.........250.........260.........270.........280
Sequence TRIHSLPSYGLENLKKLRARSTYNLKKLPTLEKLVALMEASLTYPSHCCAFANWRRQISELHPICNKSTE
Predicted secondary structure
















































SS confidence





































































Known secondary structure (DSSP) S





SSS
TT


TT
TT





TTT

S


S




SS
S








 .........290.........300......
Sequence FDDLCNEVVDVTCSPKPDAFNPCEDI
Predicted secondary structure



















SS confidence

























Known secondary structure (DSSP)



S



S
S
TTSS

S



Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D