Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c4arnD_

Fold library idPDB HeaderMoleculeTitle
c4arnD_PDB header: immune systemChain: D: PDB Molecule: toll receptor, variable lymphocyte receptor b.61 chimera;PDBTitle: crystal structure of the n-terminal domain of drosophila toll2 receptor


Added to library: Fri Feb 1 12:11:40 2013
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence SFGRDACSEMSIDGLCQCAPIMSEYEIICPANAENPTFRLTIQPKDYVQIMCNLTDTTDYQQLPKKLRIG
Predicted secondary structure






















































SS confidence





































































Known secondary structure (DSSP)

ST
SSTTSTT
SS
STTT

SSGGGGGGS
SS


 .........80.........90.........100.........110.........120.........130.........140
Sequence EVDRVQMRRCMLPGHTPIASILDYLGIVSPTTLIFESDNLGMNITRQHLDRLHGLKRFRFTTRRLTHIPA
Predicted secondary structure



















































SS confidence





































































Known secondary structure (DSSP)
SS



SSS
TTT

S
S

SS


TGGGTT
TT
S
SS




T
 .........150.........160.........170.........180.........190.........200.........210
Sequence NLLTDMRNLSHLELRANIEEMPSHLFDDLENLESIEFGSNKLRQMPRGIFGKMPKLKQLNLASNQLKSVP
Predicted secondary structure






















































SS confidence





































































Known secondary structure (DSSP) TTTTT
TT

S





TTTTTT



S

SS





TTTTTT
SS



SS

S


 .........220.........230.........240.........250.........260.........270..
Sequence DGIFDRLTSLQKIWLHTNPWDCSCPRIDYLSRWLNKNSQKEQGSAKCSGSGKPVRSIICPTT
Predicted secondary structure




































SS confidence





























































Known secondary structure (DSSP) TTTTTT
TT



SS
B


TTTTTTTTS

BBTTT

BGGG






Download:PDB structure FASTA sequence

Hidden Markov model

Image coloured by rainbow N → C terminus
Interactive 3D view in JSmol


Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Accessibility Statement
Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D